Mouse FOXQ1 Monoclonal Antibody | anti-FOXQ1 antibody

FOXQ1 (Forkhead Box Q1, HFH1) (HRP)

Cat. Num. AAA6180821

• Gene Names: FOXQ1; HFH1
• Applications: Immunofluorescence
• Purity: Purified
• Synonyms: FOXQ1; Monoclonal Antibody; FOXQ1 (Forkhead Box Q1; HFH1) (HRP); Forkhead Box Q1; HFH1; anti-FOXQ1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4H8
• Specificity: Recognizes FOXQ1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-FOXQ1 antibody: Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FOXQ1 (NP_150285, 110aa-219aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FOXQ1 is approximately 0.3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXQ1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXQ1 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-FOXQ1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 145309320
• NCBI GeneID: 94234
• NCBI Accession #: NP_150285
• NCBI GenBank Nucleotide #: NM_033260
• UniProt Accession #: Q9C009
• Molecular Weight: 41kDa
• NCBI Official Full Name: forkhead box protein Q1
• NCBI Official Synonym Full Names: forkhead box Q1
• NCBI Official Symbol: FOXQ1
• NCBI Official Synonym Symbols: HFH1
• NCBI Protein Information: forkhead box protein Q1
• UniProt Protein Name: Forkhead box protein Q1
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXQ1
• UniProt Synonym Gene Names: HFH1; HFH-1
• UniProt Entry Name: FOXQ1_HUMAN

NCBI Description

FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM, May 2009]

Uniprot Description

FOXQ1: Plays a role in hair follicle differentiation.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p25

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; hair follicle morphogenesis