Mouse anti-Human FOXP2 Monoclonal Antibody | anti-FOXP2 antibody

FOXP2 (Forkhead Box Protein P2, CAG Repeat Protein 44, Trinucleotide Repeat-containing Gene 10 Protein, CAGH44, TNRC10, DKFZp686H1726, SPCH1) (HRP)

Cat. Num. AAA6152567

• Gene Names: FOXP2; SPCH1; CAGH44; TNRC10
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FOXP2; Monoclonal Antibody; FOXP2 (Forkhead Box Protein P2; CAG Repeat Protein 44; Trinucleotide Repeat-containing Gene 10 Protein; CAGH44; TNRC10; DKFZp686H1726; SPCH1) (HRP); anti-FOXP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F8
• Specificity: Recognizes human FOXP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-FOXP2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa616-716 from human FOXP2 (NP_055306) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged FOXP2 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-FOXP2 antibody

Forkhead box protein P2 (FoxP2) is a multidomain transcriptional repressor that belongs to the Fox family of proteins. The FoxP2 protein contains a forkhead-box DNA-binding domain, characteristic of the FOX group of transcription factors. In addition, this protein contains a polyglutamine tract, as well as zinc finger and leucine zipper motifs. In order for FoxP2 to bind DNA, it forms homodimers and heterodimers with FoxP1 and FoxP4. The forkhead box family of proteins play an important role in immune response, organ development and the development of cancer. Functional studies in vertebrates suggest this with this gene plays a role in the modulation neural plasticity. In line with these findings, mutations of FoxP2 in humans have been linked to speech and language disorders.

Product Categories/Family for anti-FOXP2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 17017963
• NCBI GeneID: 93986
• NCBI Accession #: NP_055306
• NCBI GenBank Nucleotide #: NM_014491
• UniProt Accession #: O15409
• Molecular Weight: 80kDa
• NCBI Official Full Name: forkhead box protein P2 isoform I
• NCBI Official Synonym Full Names: forkhead box P2
• NCBI Official Symbol: FOXP2
• NCBI Official Synonym Symbols: SPCH1; CAGH44; TNRC10
• NCBI Protein Information: forkhead box protein P2
• UniProt Protein Name: Forkhead box protein P2
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXP2
• UniProt Synonym Gene Names: CAGH44; TNRC10
• UniProt Entry Name: FOXP2_HUMAN

NCBI Description

This gene encodes a member of the forkhead/winged-helix (FOX) family of transcription factors. It is expressed in fetal and adult brain as well as in several other organs such as the lung and gut. The protein product contains a FOX DNA-binding domain and a large polyglutamine tract and is an evolutionarily conserved transcription factor, which may bind directly to approximately 300 to 400 gene promoters in the human genome to regulate the expression of a variety of genes. This gene is required for proper development of speech and language regions of the brain during embryogenesis, and may be involved in a variety of biological pathways and cascades that may ultimately influence language development. Mutations in this gene cause speech-language disorder 1 (SPCH1), also known as autosomal dominant speech and language disorder with orofacial dyspraxia. Multiple alternative transcripts encoding different isoforms have been identified in this gene.[provided by RefSeq, Feb 2010]

Uniprot Description

FOXP2: Transcriptional repressor that may play a role in the specification and differentiation of lung epithelium. May also play a role in developing neural, gastrointestinal and cardiovascular tissues. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Involved in neural mechanisms mediating the development of speech and language. Forms homodimers and heterodimers with FOXP1 and FOXP4. Dimerization is required for DNA-binding. Interacts with CTBP1. Isoform 1 and isoform 6 are expressed in adult and fetal brain, caudate nucleus and lung. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 7q31

Cellular Component: nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; sequence-specific DNA binding; metal ion binding; transcription factor activity

Biological Process: skeletal muscle development; caudate nucleus development; camera-type eye development; transcription, DNA-dependent; righting reflex; putamen development; negative regulation of transcription from RNA polymerase II promoter; vocal learning; post-embryonic development; smooth muscle development; positive regulation of mesenchymal cell proliferation; cerebellum development; cerebral cortex development; negative regulation of transcription, DNA-dependent; alveolus development; growth

Disease: Speech-language Disorder 1