Mouse FOXO1A Monoclonal Antibody | anti-FOXO1A antibody

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (PE)

Cat. Num. AAA6185240

• Gene Names: FOXO1; FKH1; FKHR; FOXO1A
• Applications: Immunofluorescence
• Purity: Purified
• Synonyms: FOXO1A; Monoclonal Antibody; FOXO1A (Forkhead Box O1; FKH1; FKHR; FOXO1A) (PE); Forkhead Box O1; anti-FOXO1A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A2
• Specificity: Recognizes FOXO1A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-FOXO1A antibody: Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FOXO1A (NP_002006, 556aa-655aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FOXO1A is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-FOXO1A antibody

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq]

Product Categories/Family for anti-FOXO1A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 9257222
• NCBI GeneID: 2308
• NCBI Accession #: NP_002006
• NCBI GenBank Nucleotide #: NM_002015.3
• UniProt Accession #: Q12778; O43523; Q5VYC7; Q6NSK6
• Molecular Weight: 69,662 Da
• NCBI Official Full Name: forkhead box protein O1
• NCBI Official Synonym Full Names: forkhead box O1
• NCBI Official Symbol: FOXO1
• NCBI Official Synonym Symbols: FKH1; FKHR; FOXO1A
• NCBI Protein Information: forkhead box protein O1; forkhead box protein O1A; forkhead, Drosophila, homolog of, in rhabdomyosarcoma
• UniProt Protein Name: Forkhead box protein O1
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXO1
• UniProt Synonym Gene Names: FKHR; FOXO1A
• UniProt Entry Name: FOXO1_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXO1A: a transcription factor of the forkhead family. A central regulator of metabolism in several cell types. May play an important role in myogenic growth and differentiation, and in the regulation of lipolysis in adipocytes by controlling the expression of adipose triglyceride lipase (ATGL), the rate-limiting lipolytic enzyme. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. Contains 1 fork-head domain.

Protein type: Nuclear receptor co-regulator; DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 13q14.1

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; protein phosphatase 2A binding; sequence-specific DNA binding; ubiquitin protein ligase binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; fat cell differentiation; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; apoptosis; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; thermoregulation; positive regulation of gluconeogenesis; positive regulation of autophagy; epidermal growth factor receptor signaling pathway; blood vessel development; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; negative regulation of fat cell differentiation; negative regulation of stress-activated MAPK cascade; cellular response to starvation; endocrine pancreas development; protein amino acid acetylation; cellular response to insulin stimulus; insulin receptor signaling pathway; positive regulation of protein catabolic process; autophagy; cell glucose homeostasis; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; response to DNA damage stimulus; negative regulation of apoptosis

Disease: Rhabdomyosarcoma 2