Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse FOXF2 Monoclonal Antibody | anti-FOXF2 antibody

FOXF2 (Forkhead Box F2, FKHL6, FREAC2) (HRP)

Gene Names
FOXF2; FKHL6; FREAC2; FREAC-2
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
FOXF2; Monoclonal Antibody; FOXF2 (Forkhead Box F2; FKHL6; FREAC2) (HRP); Forkhead Box F2; FREAC2; anti-FOXF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D11
Specificity
Recognizes FOXF2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FOXF2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXF2 (NP_001443, 346aa-443aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FOXF2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOXF2 is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(FOXF2 monoclonal antibody (M08), clone 3D11. Western Blot analysis of FOXF2 expression in A-549.)

Western Blot (WB) (FOXF2 monoclonal antibody (M08), clone 3D11. Western Blot analysis of FOXF2 expression in A-549.)

Western Blot (WB)

(FOXF2 monoclonal antibody (M08), clone 3D11. Western Blot analysis of FOXF2 expression in human placenta.)

Western Blot (WB) (FOXF2 monoclonal antibody (M08), clone 3D11. Western Blot analysis of FOXF2 expression in human placenta.)
Product Categories/Family for anti-FOXF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
forkhead box protein F2
NCBI Official Synonym Full Names
forkhead box F2
NCBI Official Symbol
FOXF2
NCBI Official Synonym Symbols
FKHL6; FREAC2; FREAC-2
NCBI Protein Information
forkhead box protein F2
UniProt Protein Name
Forkhead box protein F2
Protein Family
UniProt Gene Name
FOXF2
UniProt Synonym Gene Names
FKHL6; FREAC2
UniProt Entry Name
FOXF2_HUMAN

NCBI Description

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq, Jul 2008]

Research Articles on FOXF2

Similar Products

Product Notes

The FOXF2 foxf2 (Catalog #AAA6180027) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXF2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXF2 foxf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.