Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Mouse anti-Human FOXD1 Monoclonal Antibody | anti-FOXD1 antibody
FOXD1 (Forkhead Box Protein D1, Forkhead-related Protein FKHL8, Forkhead-related Transcription Factor 4, FREAC-4, FKHL8, FREAC4) (Biotin)
Gene Names
FOXD1; FKHL8; FREAC4; FREAC-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOXD1; Monoclonal Antibody; FOXD1 (Forkhead Box Protein D1; Forkhead-related Protein FKHL8; Forkhead-related Transcription Factor 4; FREAC-4; FKHL8; FREAC4) (Biotin); anti-FOXD1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C10
Specificity
Recognizes human FOXD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FOXD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91 from human FOXD1 (NP_004463) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Testing Data
(Detection limit for recombinant GST tagged FOXD1 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FOXD1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-FOXD1 antibody
Transcription factor required for formation of positional identity in the developing retina, regionalization of the optic chiasm and morphogenesis of the kidney. Can neuralize ectodermal cells directly.
Product Categories/Family for anti-FOXD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,140 Da
NCBI Official Full Name
forkhead box protein D1
NCBI Official Synonym Full Names
forkhead box D1
NCBI Official Symbol
FOXD1
NCBI Official Synonym Symbols
FKHL8; FREAC4; FREAC-4
NCBI Protein Information
forkhead box protein D1; Forkhead, drosophila, homolog-like 8; forkhead-like 8; forkhead-related activator 4; forkhead-related protein FKHL8; forkhead-related transcription factor 4
UniProt Protein Name
Forkhead box protein D1
Protein Family
UniProt Gene Name
FOXD1
UniProt Synonym Gene Names
FKHL8; FREAC4; FREAC-4
UniProt Entry Name
FOXD1_HUMAN
Uniprot Description
FOXD1: Transcription factor required for formation of positional identity in the developing retina, regionalization of the optic chiasm and morphogenesis of the kidney. Can neuralize ectodermal cells directly.
Protein type: Cell development/differentiation; Motility/polarity/chemotaxis; DNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: 5q13.2
Cellular Component: nucleus
Molecular Function: DNA binding; sequence-specific DNA binding; DNA bending activity; transcription factor activity
Biological Process: axon guidance; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of BMP signaling pathway
Similar Products
Product Notes
The FOXD1 foxd1 (Catalog #AAA6141953) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXD1 (Forkhead Box Protein D1, Forkhead-related Protein FKHL8, Forkhead-related Transcription Factor 4, FREAC-4, FKHL8, FREAC4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXD1 foxd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
