Mouse anti-Human FOXC2 Monoclonal Antibody | anti-FOXC2 antibody

FOXC2 (Forkhead Box C2, Drosphilia Forkhead Homolog Like 14, FKHL14, LD, Mesenchyme Forkhead 1, MFH1, MFH-1 Protein, Transcription Factor FKH-14) (FITC)

Cat. Num. AAA6147255

• Gene Names: FOXC2; LD; MFH1; MFH-1; FKHL14
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FOXC2; Monoclonal Antibody; FOXC2 (Forkhead Box C2; Drosphilia Forkhead Homolog Like 14; FKHL14; LD; Mesenchyme Forkhead 1; MFH1; MFH-1 Protein; Transcription Factor FKH-14) (FITC); anti-FOXC2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b, lambda
• Clone Number: 2H3
• Specificity: Recognizes human FOXC2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-FOXC2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa421-501 from human FOXC2 (NP_005242.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.65kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXC2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FOXC2 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-FOXC2 antibody

Antibodies; Transcription Factors

References

1. MiR-520h-mediated FOXC2 regulation is critical for inhibition of lung cancer progression by resveratrol. Yu YH, Chen HA, Chen PS, Cheng YJ, Hsu WH, Chang YW, Chen YH, Jan Y, Hsiao M, Chang TY, Liu YH, Jeng YM, Wu CH, Huang MT, Su YH, Hung MC, Chien MH, Chen CY, Kuo ML, Su JL.Oncogene. 2012 Mar 12. doi: 10.1038/onc.2012.74. 2. FOXC2 is a Novel Prognostic Factor in Human Esophageal Squamous Cell Carcinoma. Nishida N, Mimori K, Yokobori T, Sudo T, Tanaka F, Shibata K, Ishii H, Doki Y, Mori M.Ann Surg Oncol. 2010 Aug 28.

NCBI and Uniprot Product Information

• NCBI GI #: 4885237
• NCBI GeneID: 2303
• NCBI Accession #: NP_005242.1
• NCBI GenBank Nucleotide #: NM_005251
• UniProt Accession #: Q99958; Q14DA6; C6KMR9
• Molecular Weight: 53,719 Da
• NCBI Official Full Name: forkhead box protein C2
• NCBI Official Synonym Full Names: forkhead box C2 (MFH-1, mesenchyme forkhead 1)
• NCBI Official Symbol: FOXC2
• NCBI Official Synonym Symbols: LD; MFH1; MFH-1; FKHL14
• NCBI Protein Information: forkhead box protein C2; MFH-1,mesenchyme forkhead 1; transcription factor FKH-14; mesenchyme fork head protein 1; forkhead-related protein FKHL14; forkhead, Drosophila, homolog-like 14
• UniProt Protein Name: Forkhead box protein C2
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXC2
• UniProt Synonym Gene Names: FKHL14; MFH1; MFH-1 protein
• UniProt Entry Name: FOXC2_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXC2: Transcriptional activator. Might be involved in the formation of special mesenchymal tissues. Defects in FOXC2 are the cause of lymphedema hereditary type 2 (LMPH2); also known as Meige lymphedema. Hereditary lymphedema is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections, and physical impairment. Defects in FOXC2 are a cause of lymphedema-yellow nails (LYYN). LYYN is characterized by yellow, dystrophic, thick and slowly growing nails, associated with lymphedema and respiratory involvement. Lymphedema occurs more often in the lower limbs. It can appear at birth or later in life. Onset generally follows the onset of ungual abnormalities. Defects in FOXC2 are a cause of lymphedema-distichiasis (LYD). LYD is characterized by primary limb lymphedema usually starting at puberty (but in some cases later or at birth) and associated with distichiasis (double rows of eyelashes, with extra eyelashes growing from the Meibomian gland orifices).

Protein type: Cell development/differentiation; Transcription factor; Apoptosis; DNA-binding

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; chromatin DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; collagen fibril organization; neural crest cell development; heart development; positive regulation of transcription, DNA-dependent; response to hormone stimulus; cardiac muscle cell proliferation; negative regulation of transcription from RNA polymerase II promoter; ureteric bud development; lymphangiogenesis; ventricular cardiac muscle morphogenesis; mesoderm development; regulation of blood vessel size; somitogenesis; Notch signaling pathway; ossification; camera-type eye development; positive regulation of cell adhesion mediated by integrin; regulation of organ growth; embryonic viscerocranium morphogenesis; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; paraxial mesodermal cell fate commitment; insulin receptor signaling pathway; artery morphogenesis; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; blood vessel remodeling; vascular endothelial growth factor receptor signaling pathway; metanephros development

Disease: Lymphedema-distichiasis Syndrome