Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse anti-Human FOXC1 Monoclonal Antibody | anti-FOXC1 antibody

FOXC1 (Forkhead Box Protein C1, Forkhead-related Protein FKHL7, Forkhead-related Transcription Factor 3, FREAC-3, FKHL7, FREAC3) (FITC)

Gene Names
FOXC1; ARA; IGDA; IHG1; ASGD3; FKHL7; IRID1; RIEG3; FREAC3; FREAC-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOXC1; Monoclonal Antibody; FOXC1 (Forkhead Box Protein C1; Forkhead-related Protein FKHL7; Forkhead-related Transcription Factor 3; FREAC-3; FKHL7; FREAC3) (FITC); anti-FOXC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D11
Specificity
Recognizes human FOXC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FOXC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa464-553 from human FOXC1 (NP_001444) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)
Related Product Information for anti-FOXC1 antibody
FOXC1, otherwise known as Forkhead box C1, a member of the Forkhead family of transcription factors, shown to be involved in the development of the eye. Studies have shown that FOXC1 plays an important role in the regulation of the FGF19-FGFR4-MAPK pathway involved in the maintenance of anterior segment structures within the eye. Studies have also shown that FOXC1 is essential for the aggressive phenotype of basal-like triple-negative breast cancer (TNBC), for which FOXC1 may prove to be a valuable test marker. Mutations in the FOXC1 gene are responsible for various ocular abnormalities including Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis anomaly (IGDA), and Peters anomaly.
Product Categories/Family for anti-FOXC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
forkhead box protein C1
NCBI Official Synonym Full Names
forkhead box C1
NCBI Official Symbol
FOXC1
NCBI Official Synonym Symbols
ARA; IGDA; IHG1; ASGD3; FKHL7; IRID1; RIEG3; FREAC3; FREAC-3
NCBI Protein Information
forkhead box protein C1
UniProt Protein Name
Forkhead box protein C1
Protein Family
UniProt Gene Name
FOXC1
UniProt Synonym Gene Names
FKHL7; FREAC3; FREAC-3
UniProt Entry Name
FOXC1_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXC1: Binding of FREAC-3 and FREAC-4 to their cognate sites results in bending of the DNA at an angle of 80-90 degrees. Monomer. Expressed in all tissues and cell lines examined.

Protein type: Transcription factor; Cell development/differentiation; DNA-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 6p25

Cellular Component: nucleoplasm; cytoplasm; nuclear heterochromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; DNA binding; sequence-specific DNA binding; transcription factor binding; DNA bending activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; collagen fibril organization; neural crest cell development; glycosaminoglycan metabolic process; paraxial mesoderm formation; positive regulation of transcription, DNA-dependent; heart development; cardiac muscle cell proliferation; ovarian follicle development; regulation of transcription, DNA-dependent; ureteric bud development; germ cell migration; ventricular cardiac muscle morphogenesis; negative regulation of mitotic cell cycle; lacrimal gland development; regulation of blood vessel size; skeletal development; mesenchymal cell development; ossification; somitogenesis; Notch signaling pathway; cell migration; camera-type eye development; in utero embryonic development; regulation of organ growth; odontogenesis of dentine-containing teeth; cell proliferation; eye development; artery morphogenesis; embryonic heart tube development; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; brain development; vascular endothelial growth factor receptor signaling pathway; lymph vessel development

Disease: Axenfeld-rieger Syndrome, Type 3; Iridogoniodysgenesis, Type 1

Research Articles on FOXC1

Similar Products

Product Notes

The FOXC1 foxc1 (Catalog #AAA6147254) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXC1 (Forkhead Box Protein C1, Forkhead-related Protein FKHL7, Forkhead-related Transcription Factor 3, FREAC-3, FKHL7, FREAC3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXC1 foxc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.