Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.09kD).)

Mouse anti-Human FOXA3 Monoclonal Antibody | anti-FOXA3 antibody

FOXA3 (Hepatocyte Nuclear Factor 3-gamma, HNF-3-gamma, HNF-3G, Forkhead Box Protein A3, Fork Head-related Protein FKH H3, TCF3G, HNF3G, MGC10179) (PE)

Gene Names
FOXA3; FKHH3; HNF3G; TCF3G
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOXA3; Monoclonal Antibody; FOXA3 (Hepatocyte Nuclear Factor 3-gamma; HNF-3-gamma; HNF-3G; Forkhead Box Protein A3; Fork Head-related Protein FKH H3; TCF3G; HNF3G; MGC10179) (PE); anti-FOXA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C6
Specificity
Recognizes human FOXA3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FOXA3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa266-350 from human FOXA3 (NP_004488.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.09kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.09kD).)

Testing Data

(Detection limit for recombinant GST tagged FOXA3 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOXA3 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-FOXA3 antibody
FOXA3 is a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes.
Product Categories/Family for anti-FOXA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,140 Da
NCBI Official Full Name
hepatocyte nuclear factor 3-gamma
NCBI Official Synonym Full Names
forkhead box A3
NCBI Official Symbol
FOXA3
NCBI Official Synonym Symbols
FKHH3; HNF3G; TCF3G
NCBI Protein Information
hepatocyte nuclear factor 3-gamma
UniProt Protein Name
Hepatocyte nuclear factor 3-gamma
Protein Family
UniProt Gene Name
FOXA3
UniProt Synonym Gene Names
HNF3G; TCF3G; HNF-3-gamma; HNF-3G; TCF-3G
UniProt Entry Name
FOXA3_HUMAN

NCBI Description

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXA3: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleus

Molecular Function: protein domain specific binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: cell differentiation; cell glucose homeostasis; cellular response to starvation; chromatin modification; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; transcription, DNA-dependent

Research Articles on FOXA3

Similar Products

Product Notes

The FOXA3 foxa3 (Catalog #AAA6157859) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXA3 (Hepatocyte Nuclear Factor 3-gamma, HNF-3-gamma, HNF-3G, Forkhead Box Protein A3, Fork Head-related Protein FKH H3, TCF3G, HNF3G, MGC10179) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXA3 foxa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.