Mouse anti-Human FOXA2 Monoclonal Antibody | anti-FOXA2 antibody

FOXA2 (HNF3B, TCF3B, Forkhead Box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (AP)

Cat. Num. AAA6134798

• Gene Names: FOXA2; HNF3B; TCF3B
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: FOXA2; Monoclonal Antibody; FOXA2 (HNF3B; TCF3B; Forkhead Box A2; OTTHUMP00000030409; MGC19807; OTTHUMP00000030410; Hepatic Nuclear Factor-3-beta; Hepatocyte Nuclear Factor 3; beta) (AP); anti-FOXA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4G11
• Specificity: Recognizes human FOXA2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-FOXA2 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa363-457 from human FOXA2 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (36.19kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase on formalin-fixed paraffin-embedded human small Intestine using 207645 (0.2ug/ml).)

Related Product Information for anti-FOXA2 antibody

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene.

Product Categories/Family for anti-FOXA2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 194394143
• NCBI GeneID: 3170
• NCBI Accession #: NP_068556
• NCBI GenBank Nucleotide #: NM_021784.4
• UniProt Accession #: Q9Y261; Q8WUW4; Q96DF7
• Molecular Weight: Predicted: 51 kDa; ; Observed: 54 kDa
• NCBI Official Full Name: hepatocyte nuclear factor 3-beta isoform 1
• NCBI Official Synonym Full Names: forkhead box A2
• NCBI Official Symbol: FOXA2
• NCBI Official Synonym Symbols: HNF3B; TCF3B
• NCBI Protein Information: hepatocyte nuclear factor 3-beta; HNF-3B; TCF-3B; HNF-3-beta; forkhead box protein A2; transcription factor 3B; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3, beta
• UniProt Protein Name: Hepatocyte nuclear factor 3-beta
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXA2
• UniProt Synonym Gene Names: HNF3B; TCF3B; HNF-3-beta; HNF-3B; TCF-3B
• UniProt Entry Name: FOXA2_HUMAN

NCBI Description

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]