Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FOXA1 monoclonal antibody (M04), clone 6B12 Western Blot analysis of FOXA1 expression in HepG2 (Cat # L019V1).)

Mouse FOXA1 Monoclonal Antibody | anti-FOXA1 antibody

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (FITC)

Gene Names
FOXA1; HNF3A; TCF3A
Applications
Western Blot
Purity
Purified
Synonyms
FOXA1; Monoclonal Antibody; FOXA1 (Forkhead Box A1; HNF3A; MGC33105; TCF3A) (FITC); Forkhead Box A1; TCF3A; anti-FOXA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B12
Specificity
Recognizes FOXA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FOXA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXA1 (NP_004487, 367aa-472aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FOXA1 monoclonal antibody (M04), clone 6B12 Western Blot analysis of FOXA1 expression in HepG2 (Cat # L019V1).)

Western Blot (WB) (FOXA1 monoclonal antibody (M04), clone 6B12 Western Blot analysis of FOXA1 expression in HepG2 (Cat # L019V1).)

Testing Data

(Detection limit for recombinant GST tagged FOXA1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOXA1 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-FOXA1 antibody
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq]
Product Categories/Family for anti-FOXA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
hepatocyte nuclear factor 3-alpha
NCBI Official Synonym Full Names
forkhead box A1
NCBI Official Symbol
FOXA1
NCBI Official Synonym Symbols
HNF3A; TCF3A
NCBI Protein Information
hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A
UniProt Protein Name
Hepatocyte nuclear factor 3-alpha
Protein Family
UniProt Gene Name
FOXA1
UniProt Synonym Gene Names
HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
UniProt Entry Name
FOXA1_HUMAN

NCBI Description

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXA1: Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3'. Proposed to play a role in translating the epigenetic signatures into cell type-specific enhancer-driven transcriptional programs. Its differential recruitment to chromatin is dependent on distribution of histone H3 methylated at 'Lys-5' (H3K4me2) in estrogen-regulated genes. Involved in the development of multiple endoderm-derived organ systems such as liver, pancreas, lung and prostate; FOXA1 and FOXA2 seem to have at least in part redundant roles. Modulates the transcriptional activity of nuclear hormone receptors. Is involved in ESR1-mediated transcription; required for ESR1 binding to the NKX2-1 promoter in breast cancer cells; binds to the RPRM promter and is required for the estrogen-induced repression of RPRM. Involved in regulation of apoptosis by inhibiting the expression of BCL2. Involved in cell cycle regulation by activating expression of p27Kip1, alone or in conjunction with BRCA1. Originally discribed as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis- acting regulatory regions of these genes. Involved in glucose homeostasis. Binds DNA as a monomer. Interacts with FOXA2. Interacts with NKX2-1. Interacts with HDAC7. Interacts with the histone H3-H4 heterodimer. Associates with nucleosomes containing histone H2A. Interacts with AR. Interacts with NR0B2. Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 14q21.1

Cellular Component: microvillus; nucleolus; nucleus

Molecular Function: protein domain specific binding; DNA binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; positive regulation of estrogen receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; positive regulation of mitotic cell cycle; response to estradiol stimulus; chromatin remodeling; anatomical structure formation; positive regulation of smoothened signaling pathway; hormone metabolic process; neuron fate specification; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of neuron differentiation; dorsoventral neural tube patterning

Research Articles on FOXA1

Similar Products

Product Notes

The FOXA1 foxa1 (Catalog #AAA6175481) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXA1 foxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.