Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FOSL2 is approximately 3ng/ml as a capture antibody.)

Mouse FOSL2 Monoclonal Antibody | anti-FOSL2 antibody

FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (PE)

Gene Names
FOSL2; FRA2
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
FOSL2; Monoclonal Antibody; FOSL2 (FOS-like antigen 2; FLJ23306; FRA2) (PE); FOS-like antigen 2; FRA2; anti-FOSL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B2
Specificity
Recognizes FOSL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FOSL2 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOSL2 (NP_005244, 207aa-296aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FOSL2 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOSL2 is approximately 3ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FOSL2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FOSL2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FOSL2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FOSL2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-FOSL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.6kDa (349aa)
NCBI Official Full Name
fos-related antigen 2
NCBI Official Synonym Full Names
FOS like 2, AP-1 transcription factor subunit
NCBI Official Symbol
FOSL2
NCBI Official Synonym Symbols
FRA2
NCBI Protein Information
fos-related antigen 2
UniProt Protein Name
Fos-related antigen 2
Protein Family
UniProt Gene Name
FOSL2
UniProt Synonym Gene Names
FRA2; FRA-2
UniProt Entry Name
FOSL2_HUMAN

NCBI Description

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq, Jul 2014]

Uniprot Description

FRA2: an oncogenic transcription factor of the bZIP family, Fos subfamily. The expression of Fos proteins is rapidly and transiently induced by a variety of extracellular stimuli including growth factors, cytokines, neurotransmitters, polypeptide hormones, and stress. Fos proteins dimerize with Jun proteins (c-Jun, JunB, and JunD) to form Activator Protein-1 (AP-1), a transcription factor that binds to TRE/AP-1 elements and activates transcription. Fos and Jun proteins contain the leucine-zipper motif that mediates dimerization and an adjacent basic domain that binds to DNA. The various Fos/Jun heterodimers differ in their ability to transactivate AP-1 dependent genes. In addition to increased expression, phosphorylation of Fos proteins by Erk kinases in response to extracellular stimuli may further increase transcriptional activity. Following growth factor stimulation, expression of FosB and c-Fos in quiescent fibroblasts is immediate but short-lived, while FRA1 and FRA2 expression persists longer. FRA2 and JUND up-regulate the expression of CCR4, MYB, MDM2, and BCL6, and are expressed at high levels in CCR4-expressing mature T-cell malignancies such as adult T-cell leukemia/lymphoma (ATLL) and cutaneous T-cell lymphomas (CTCLs). May play a role in regulating the transcription of ICOS downstream of TCR/CD28 and cytokine receptor signaling. Its transcription is significantly increased in metastatic clear cell renal cell carcinomas. Belongs to the bZIP family, Fos subfamily. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: nucleoplasm; nucleus

Molecular Function: double-stranded DNA binding; transcription factor activity

Biological Process: response to drug; cell death; regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; positive regulation of fibroblast proliferation; response to cAMP; response to mechanical stimulus; response to morphine; female pregnancy; response to progesterone stimulus; cellular response to hormone stimulus; response to corticosterone stimulus

Research Articles on FOSL2

Similar Products

Product Notes

The FOSL2 fosl2 (Catalog #AAA6185573) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOSL2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOSL2 fosl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOSL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.