Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOS on HeLa cell. [antibody concentration 10 ug/ml])

Mouse FOS Monoclonal Antibody | anti-FOS antibody

FOS (v-fos FBJ murine Osteosarcoma Viral Oncogene Homolog, AP-1, C-FOS) (AP)

Gene Names
FOS; p55; AP-1; C-FOS
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
FOS; Monoclonal Antibody; FOS (v-fos FBJ murine Osteosarcoma Viral Oncogene Homolog; AP-1; C-FOS) (AP); v-fos FBJ murine Osteosarcoma Viral Oncogene Homolog; C-FOS; anti-FOS antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D12
Specificity
Recognizes FOS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-FOS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOS (NP_005243.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOS on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOS on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOS on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOS on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-FOS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,695 Da
NCBI Official Full Name
proto-oncogene c-Fos
NCBI Official Synonym Full Names
FBJ murine osteosarcoma viral oncogene homolog
NCBI Official Symbol
FOS
NCBI Official Synonym Symbols
p55; AP-1; C-FOS
NCBI Protein Information
proto-oncogene c-Fos; activator protein 1; cellular oncogene c-fos; G0/G1 switch regulatory protein 7; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS)
UniProt Protein Name
Proto-oncogene c-Fos
Protein Family
UniProt Gene Name
FOS
UniProt Synonym Gene Names
G0S7
UniProt Entry Name
FOS_HUMAN

NCBI Description

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq, Jul 2008]

Uniprot Description

Fos: a proto-oncogenic transcription factor of the bZIP family. Dimerizes with proteins of the JUN family, thereby forming the transcription factor complex AP-1. FOS proteins function as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of FOS has also been associated with apoptotic cell death. Expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury.

Protein type: Motility/polarity/chemotaxis; DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: nucleoplasm; transcription factor complex; neuron projection; membrane; endoplasmic reticulum; nucleus; cytosol

Molecular Function: protein binding; double-stranded DNA binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; response to gravity; response to cAMP; positive regulation of osteoclast differentiation; response to toxin; positive regulation of transcription, DNA-dependent; stress-activated MAPK cascade; response to lipopolysaccharide; toll-like receptor 3 signaling pathway; female pregnancy; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of transcription factor activity; transforming growth factor beta receptor signaling pathway; conditioned taste aversion; DNA methylation; inflammatory response; toll-like receptor 4 signaling pathway; aging; response to corticosterone stimulus; response to drug; response to light stimulus; nervous system development; MyD88-independent toll-like receptor signaling pathway; sleep; cellular response to hormone stimulus; toll-like receptor 2 signaling pathway; regulation of transcription from RNA polymerase II promoter; MyD88-dependent toll-like receptor signaling pathway; response to mechanical stimulus; response to cytokine stimulus; cellular response to extracellular stimulus; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; response to cold; response to progesterone stimulus

Research Articles on FOS

Similar Products

Product Notes

The FOS fos (Catalog #AAA6165631) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOS fos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.