Mouse FNBP1L Monoclonal Antibody | anti-FNBP1L antibody

FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (HRP)

Cat. Num. AAA6183156

• Gene Names: FNBP1L; TOCA1; C1orf39
• Applications: Western Blot
• Purity: Purified
• Synonyms: FNBP1L; Monoclonal Antibody; FNBP1L (Formin Binding Protein 1-like; C1orf39; TOCA1) (HRP); Formin Binding Protein 1-like; TOCA1; anti-FNBP1L antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1000000
• Specificity: Recognizes FNBP1L.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-FNBP1L antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FNBP1L (NP_060207.2, 175aa-239aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FNBP1L monoclonal antibody (M01), clone 1E6. Western Blot analysis of FNBP1L expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged FNBP1L is 1 ng/ml as a capture antibody.)

Product Categories/Family for anti-FNBP1L antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 41581463
• NCBI GeneID: 54874
• NCBI Accession #: NP_060207.2
• NCBI GenBank Nucleotide #: NM_017737.4
• UniProt Accession #: Q5T0N5; Q5T0N6; Q6B097; Q6P653; Q6R4Q4; Q9NXG1; J3QSS4
• Molecular Weight: 69,894 Da
• NCBI Official Full Name: formin-binding protein 1-like isoform 2
• NCBI Official Synonym Full Names: formin binding protein 1-like
• NCBI Official Symbol: FNBP1L
• NCBI Official Synonym Symbols: TOCA1; C1orf39
• NCBI Protein Information: formin-binding protein 1-like; toca-1; transducer of Cdc42-dependent actin assembly 1; transducer of Cdc42-dependent actin assembly protein 1
• UniProt Protein Name: Formin-binding protein 1-like
• Protein Family: Formin-binding protein
• UniProt Gene Name: FNBP1L
• UniProt Synonym Gene Names: C1orf39; TOCA1; Toca-1
• UniProt Entry Name: FBP1L_HUMAN

NCBI Description

The protein encoded by this gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

FNBP1L: Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. May bind to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promote membrane invagination and the formation of tubules. Also promotes CDC42-induced actin polymerization by activating the WASL/N-WASP-WASPIP/WIP complex, the predominant form of WASL/N-WASP in cells. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. Essential for autophagy of intracellular bacterial pathogens. Belongs to the FNBP1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p22.1

Cellular Component: cytoskeleton; cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane; cell cortex

Molecular Function: protein binding; lipid binding

Biological Process: positive regulation of filopodium formation; vesicle transport along actin filament; vesicle organization and biogenesis; membrane invagination; cilium biogenesis; autophagy; membrane budding