Mouse anti-Human FMR1 Monoclonal Antibody | anti-FMR1 antibody

FMR1 (Fragile X Mental Retardation 1 Protein, Protein FMR-1, FMRP) (FITC)

Cat. Num. AAA6147243

• Gene Names: FMR1; POF; FMRP; POF1; FRAXA
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FMR1; Monoclonal Antibody; FMR1 (Fragile X Mental Retardation 1 Protein; Protein FMR-1; FMRP) (FITC); anti-FMR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D4
• Specificity: Recognizes human FMR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-FMR1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa121-220 from human FMR1 (NP_002015) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(FMR1 monoclonal antibody, Western Blot analysis of FMR1 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of FMR1 expression in transfected 293T cell line by FMR1 monoclonal antibody. Lane 1: FMR1 transfected lysate (34.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged FMR1 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of FMR1 over-expressed 293 cell line, cotransfected with FMR1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FMR1 monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-FMR1 antibody

FMR1 binds RNA and is associated with polysomes. This protein may be involved in mRNA trafficking from the nucleus to the cytoplasm.

Product Categories/Family for anti-FMR1 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4503765
• NCBI GeneID: 2332
• NCBI Accession #: NP_002015
• NCBI GenBank Nucleotide #: NM_002024
• UniProt Accession #: Q06787; Q16578; Q5PQZ6; Q99054; A6NNH4; D3DWT0; D3DWT1; D3DWT2; G8JL90
• Molecular Weight: Predicted: 70 kDa; ; Observed: 74 kDa
• NCBI Official Full Name: fragile X mental retardation protein 1 isoform ISO1
• NCBI Official Synonym Full Names: fragile X mental retardation 1
• NCBI Official Symbol: FMR1
• NCBI Official Synonym Symbols: POF; FMRP; POF1; FRAXA
• NCBI Protein Information: fragile X mental retardation protein 1
• UniProt Protein Name: Fragile X mental retardation protein 1
• Protein Family: Mat- sexual cell fertilization-promoting factor
• UniProt Gene Name: FMR1
• UniProt Synonym Gene Names: FMRP; Protein FMR-1
• UniProt Entry Name: FMR1_HUMAN

NCBI Description

The protein encoded by this gene binds RNA and is associated with polysomes. The encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene. [provided by RefSeq, May 2010]