Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FLT4 is approximately 0.03ng/ml as a capture antibody.)

Mouse FLT4 Monoclonal Antibody | anti-FLT4 antibody

FLT4 (Fms-Related Tyrosine Kinase 4, FLT41, LMPH1A, PCL, VEGFR3) (FITC)

Gene Names
FLT4; PCL; FLT41; LMPH1A; VEGFR3
Applications
Western Blot
Purity
Purified
Synonyms
FLT4; Monoclonal Antibody; FLT4 (Fms-Related Tyrosine Kinase 4; FLT41; LMPH1A; PCL; VEGFR3) (FITC); Fms-Related Tyrosine Kinase 4; VEGFR3; anti-FLT4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5B6
Specificity
Recognizes FLT4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FLT4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FLT4 (NP_002011, 34aa-133aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FLT4 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FLT4 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-FLT4 antibody
This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq]
Product Categories/Family for anti-FLT4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
152,757 Da
NCBI Official Full Name
vascular endothelial growth factor receptor 3 isoform 2
NCBI Official Synonym Full Names
fms-related tyrosine kinase 4
NCBI Official Symbol
FLT4
NCBI Official Synonym Symbols
PCL; FLT41; LMPH1A; VEGFR3
NCBI Protein Information
vascular endothelial growth factor receptor 3; FLT-4; VEGFR-3; soluble VEGFR3 variant 1; soluble VEGFR3 variant 2; soluble VEGFR3 variant 3; fms-like tyrosine kinase 4; tyrosine-protein kinase receptor FLT4
UniProt Protein Name
Vascular endothelial growth factor receptor 3
UniProt Gene Name
FLT4
UniProt Synonym Gene Names
VEGFR3; VEGFR-3; FLT-4
UniProt Entry Name
VGFR3_HUMAN

NCBI Description

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq, Jul 2008]

Uniprot Description

VEGFR3: Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFC and VEGFD, and plays an essential role in adult lymphangiogenesis and in the development of the vascular network and the cardiovascular system during embryonic development. Promotes proliferation, survival and migration of endothelial cells, and regulates angiogenic sprouting. Signaling by activated FLT4 leads to enhanced production of VEGFC, and to a lesser degree VEGFA, thereby creating a positive feedback loop that enhances FLT4 signaling. Modulates KDR signaling by forming heterodimers. The secreted isoform 3 may function as a decoy receptor for VEGFC and/or VEGFD and play an important role as a negative regulator of VEGFC-mediated lymphangiogenesis and angiogenesis. Binding of vascular growth factors to isoform 1 or isoform 2 leads to the activation of several signaling cascades; isoform 2 seems to be less efficient in signal transduction, because it has a truncated C-terminus and therefore lacks several phosphorylation sites. Mediates activation of the MAPK1/ERK2, MAPK3/ERK1 signaling pathway, of MAPK8 and the JUN signaling pathway, and of the AKT1 signaling pathway. Phosphorylates SHC1. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3- kinase. Promotes phosphorylation of MAPK8 at 'Thr-183' and 'Tyr- 185', and of AKT1 at 'Ser-473'. Interacts with VEGFC and VEGFD. Monomer in the absence of bound VEGFC or VEGFD. Homodimer in the presence of bound VEGFC or VEGFD. Can also form a heterodimer with KDR. Interacts with PTPN14; the interaction is enhanced by stimulation with VEGFC. Interacts with CRK, GRB2, PTK2/FAK1, SHC1, PIK3R1 and PTPN11/SHP- 2. Identified in a complex with SRC and ITGB1. Detected in endothelial cells. Widely expressed. Detected in fetal spleen, lung and brain. Detected in adult liver, muscle, thymus, placenta, lung, testis, ovary, prostate, heart, and kidney. Present in an inactive conformation in the absence of bound ligand. Binding of VEGFC or VEGFD leads to dimerization and activation by autophosphorylation on tyrosine residues. Inhibited by MAZ51. Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.10.1; TK group; VEGFR family

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: integral to plasma membrane; cytoplasm; extracellular region; plasma membrane; nucleus; receptor complex

Molecular Function: vascular endothelial growth factor receptor activity; protein binding; growth factor binding; transmembrane receptor protein tyrosine kinase activity; protein phosphatase binding; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; positive regulation of JNK cascade; vasculature development; positive regulation of MAPKKK cascade; lymphangiogenesis; positive regulation of cell proliferation; blood vessel morphogenesis; positive regulation of endothelial cell proliferation; sprouting angiogenesis; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; lymph vessel development; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Disease: Hemangioma, Capillary Infantile; Lymphedema, Hereditary, Ia

Research Articles on FLT4

Similar Products

Product Notes

The FLT4 flt4 (Catalog #AAA6174823) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FLT4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FLT4 flt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FLT4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.