Mouse FLT4 Monoclonal Antibody | anti-FLT4 antibody

FLT4 (Fms-Related Tyrosine Kinase 4, FLT41, LMPH1A, PCL, VEGFR3) (Biotin)

Cat. Num. AAA6171841

• Gene Names: FLT4; PCL; FLT41; LMPH1A; VEGFR3
• Applications: Western Blot
• Purity: Purified
• Synonyms: FLT4; Monoclonal Antibody; FLT4 (Fms-Related Tyrosine Kinase 4; FLT41; LMPH1A; PCL; VEGFR3) (Biotin); Fms-Related Tyrosine Kinase 4; VEGFR3; anti-FLT4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2000
• Specificity: Recognizes FLT4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FLT4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FLT4 (NP_002011, 34aa-133aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FLT4 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-FLT4 antibody

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq]

Product Categories/Family for anti-FLT4 antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 103472027
• NCBI GeneID: 2324
• NCBI Accession #: NP_002011
• NCBI GenBank Nucleotide #: NM_002020
• UniProt Accession #: P35916; Q16067; Q86W07; Q86W08; A8K6L4; B5A926; AAB23636
• Molecular Weight: 152,757 Da
• NCBI Official Full Name: vascular endothelial growth factor receptor 3 isoform 2
• NCBI Official Synonym Full Names: fms-related tyrosine kinase 4
• NCBI Official Symbol: FLT4
• NCBI Official Synonym Symbols: PCL; FLT41; LMPH1A; VEGFR3
• NCBI Protein Information: vascular endothelial growth factor receptor 3; FLT-4; VEGFR-3; soluble VEGFR3 variant 1; soluble VEGFR3 variant 2; soluble VEGFR3 variant 3; fms-like tyrosine kinase 4; tyrosine-protein kinase receptor FLT4
• UniProt Protein Name: Vascular endothelial growth factor receptor 3
• Protein Family: Vascular endothelial growth factor receptor
• UniProt Gene Name: FLT4
• UniProt Synonym Gene Names: VEGFR3; VEGFR-3; FLT-4
• UniProt Entry Name: VGFR3_HUMAN

NCBI Description

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq, Jul 2008]

Uniprot Description

VEGFR3: Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFC and VEGFD, and plays an essential role in adult lymphangiogenesis and in the development of the vascular network and the cardiovascular system during embryonic development. Promotes proliferation, survival and migration of endothelial cells, and regulates angiogenic sprouting. Signaling by activated FLT4 leads to enhanced production of VEGFC, and to a lesser degree VEGFA, thereby creating a positive feedback loop that enhances FLT4 signaling. Modulates KDR signaling by forming heterodimers. The secreted isoform 3 may function as a decoy receptor for VEGFC and/or VEGFD and play an important role as a negative regulator of VEGFC-mediated lymphangiogenesis and angiogenesis. Binding of vascular growth factors to isoform 1 or isoform 2 leads to the activation of several signaling cascades; isoform 2 seems to be less efficient in signal transduction, because it has a truncated C-terminus and therefore lacks several phosphorylation sites. Mediates activation of the MAPK1/ERK2, MAPK3/ERK1 signaling pathway, of MAPK8 and the JUN signaling pathway, and of the AKT1 signaling pathway. Phosphorylates SHC1. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3- kinase. Promotes phosphorylation of MAPK8 at 'Thr-183' and 'Tyr- 185', and of AKT1 at 'Ser-473'. Interacts with VEGFC and VEGFD. Monomer in the absence of bound VEGFC or VEGFD. Homodimer in the presence of bound VEGFC or VEGFD. Can also form a heterodimer with KDR. Interacts with PTPN14; the interaction is enhanced by stimulation with VEGFC. Interacts with CRK, GRB2, PTK2/FAK1, SHC1, PIK3R1 and PTPN11/SHP- 2. Identified in a complex with SRC and ITGB1. Detected in endothelial cells. Widely expressed. Detected in fetal spleen, lung and brain. Detected in adult liver, muscle, thymus, placenta, lung, testis, ovary, prostate, heart, and kidney. Present in an inactive conformation in the absence of bound ligand. Binding of VEGFC or VEGFD leads to dimerization and activation by autophosphorylation on tyrosine residues. Inhibited by MAZ51. Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.10.1; TK group; VEGFR family

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: integral to plasma membrane; cytoplasm; extracellular region; plasma membrane; nucleus; receptor complex

Molecular Function: vascular endothelial growth factor receptor activity; protein binding; growth factor binding; transmembrane receptor protein tyrosine kinase activity; protein phosphatase binding; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; positive regulation of JNK cascade; vasculature development; positive regulation of MAPKKK cascade; lymphangiogenesis; positive regulation of cell proliferation; blood vessel morphogenesis; positive regulation of endothelial cell proliferation; sprouting angiogenesis; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; lymph vessel development; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Disease: Hemangioma, Capillary Infantile; Lymphedema, Hereditary, Ia