Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Flt3 Ligand Monoclonal Antibody | anti-FLT3LG antibody

Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (MaxLight 490)

Gene Names
FLT3LG; FL; FLG3L; FLT3L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Flt3 Ligand; Monoclonal Antibody; Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand; FL; flk2 Ligand; Fms Related Tyrosine Kinase 3 Ligand; Flt3-L; Flt 3L; Flt3 L; FLT3 LG; Flt3L; FLT3LG; SL Cytokine) (MaxLight 490); anti-FLT3LG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C4
Specificity
Recognizes human FLT3LG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-FLT3LG antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa27-136 from human FLT3LG (NP_001450) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FLT3LG antibody
Flt3L exists in both a membrane-bound and proteolytically cleaved soluble isoform, both of which are biologically active, and initiates cell proliferation/ differentiation signalling in co-operation with other colony stimulating factors (CSFs) and interleukins, by binding to and activating the tyrosine kinase receptor Flt3 (FLT3R), expressed highly by hematopoietic progenitor cells and stem cells.
Product Categories/Family for anti-FLT3LG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.0kDa (166aa) 18-28KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
fms-related tyrosine kinase 3 ligand isoform 1
NCBI Official Synonym Full Names
fms related tyrosine kinase 3 ligand
NCBI Official Symbol
FLT3LG
NCBI Official Synonym Symbols
FL; FLG3L; FLT3L
NCBI Protein Information
fms-related tyrosine kinase 3 ligand
UniProt Protein Name
Fms-related tyrosine kinase 3 ligand
UniProt Gene Name
FLT3LG
UniProt Synonym Gene Names
Flt3 ligand; Flt3L
UniProt Entry Name
FLT3L_HUMAN

NCBI Description

Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]

Uniprot Description

FLT3LG: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Ligand, receptor tyrosine kinase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: extracellular space; membrane; integral to membrane

Molecular Function: protein homodimerization activity; cytokine activity; receptor tyrosine kinase binding; receptor binding

Biological Process: positive regulation of natural killer cell differentiation; regulation of myeloid dendritic cell activation; lymphocyte differentiation; embryonic hemopoiesis; positive regulation of cell proliferation; positive regulation of protein amino acid phosphorylation; signal transduction; positive regulation of myoblast differentiation

Research Articles on FLT3LG

Similar Products

Product Notes

The FLT3LG flt3lg (Catalog #AAA6200867) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Flt3 Ligand can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FLT3LG flt3lg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Flt3 Ligand, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.