Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FLT3 is 0.1 ng/ml as a capture antibody.)

Mouse FLT3 Monoclonal Antibody | anti-FLT3 antibody

FLT3 (Fms-Related Tyrosine Kinase 3, CD135, FLK2, STK1) (AP)

Gene Names
FLT3; FLK2; STK1; CD135; FLK-2
Applications
ELISA
Purity
Purified
Synonyms
FLT3; Monoclonal Antibody; FLT3 (Fms-Related Tyrosine Kinase 3; CD135; FLK2; STK1) (AP); Fms-Related Tyrosine Kinase 3; STK1; anti-FLT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H1
Specificity
Recognizes FLT3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-FLT3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FLT3 (NP_004110, 91aa-190aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FLT3 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FLT3 is 0.1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FLT3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FLT3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FLT3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FLT3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-FLT3 antibody
Mouse monoclonal antibody raised against a partial recombinant FLT3.
Product Categories/Family for anti-FLT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109 kDa
NCBI Official Full Name
receptor-type tyrosine-protein kinase FLT3
NCBI Official Synonym Full Names
fms-related tyrosine kinase 3
NCBI Official Symbol
FLT3
NCBI Official Synonym Symbols
FLK2; STK1; CD135; FLK-2
NCBI Protein Information
receptor-type tyrosine-protein kinase FLT3; CD135 antigen; FL cytokine receptor; fetal liver kinase 2; fms-like tyrosine kinase 3; stem cell tyrosine kinase 1; growth factor receptor tyrosine kinase type III
UniProt Protein Name
Receptor-type tyrosine-protein kinase FLT3
UniProt Gene Name
FLT3
UniProt Synonym Gene Names
CD135; FLK2; STK1; FLK-2; FLT-3; STK-1
UniProt Entry Name
FLT3_HUMAN

NCBI Description

This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq, Jan 2015]

Uniprot Description

FLT3: a receptor tyrosine kinase of the PDGFR family that binds the FL cytokine. FLT3 -/- mice have an impaired developmental capacity of primitive hematopoietic progenitor cells of all lineages with the greatest impact on lymphopoietic precursors. Activating mutations found in one third of cases of acute myeloid leukemia (AML), as well as in acute lymphoblastic leukemia, acute promyelocytic leukemia and myelodysplastic syndrome. Inhibitors: Sutent and PKC412.

Protein type: Kinase, protein; Membrane protein, integral; EC 2.7.10.1; Oncoprotein; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group; PDGFR family

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: protein complex; integral to plasma membrane; endoplasmic reticulum lumen; cytosol; nucleus; external side of plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; vascular endothelial growth factor receptor activity; protein binding; protein homodimerization activity; protein complex binding; phosphoinositide 3-kinase binding; transmembrane receptor protein tyrosine kinase activity; ATP binding; glucocorticoid receptor binding

Biological Process: negative regulation of B cell differentiation; lymphocyte proliferation; pro-B cell differentiation; organ regeneration; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; cytokine and chemokine mediated signaling pathway; positive regulation of phosphoinositide 3-kinase activity; response to organic nitrogen; positive regulation of phosphoinositide 3-kinase cascade; regulation of apoptosis; negative regulation of cell proliferation; positive regulation of MAP kinase activity; positive regulation of tyrosine phosphorylation of STAT protein; myeloid progenitor cell differentiation; positive regulation of MAPKKK cascade; B cell differentiation; positive regulation of cell proliferation; hemopoiesis; pro-T cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; leukocyte homeostasis

Disease: Leukemia, Acute Lymphoblastic

Research Articles on FLT3

Similar Products

Product Notes

The FLT3 flt3 (Catalog #AAA6165248) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FLT3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FLT3 flt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FLT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.