Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FLJ23356 Monoclonal Antibody | anti-FLJ23356 antibody

FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (MaxLight 750)

Gene Names
POMK; SGK196; MDDGA12; MDDGC12
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FLJ23356; Monoclonal Antibody; FLJ23356 (SGK196; Probable Inactive Protein Kinase-like Protein SgK196; Sugen Kinase 196; MGC126597) (MaxLight 750); anti-FLJ23356 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F10
Specificity
Recognizes human FLJ23356.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-FLJ23356 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa251-351 from human FLJ23356 (NP_115613) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-FLJ23356 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
protein O-mannose kinase
NCBI Official Synonym Full Names
protein-O-mannose kinase
NCBI Official Symbol
POMK
NCBI Official Synonym Symbols
SGK196; MDDGA12; MDDGC12
NCBI Protein Information
protein O-mannose kinase
UniProt Protein Name
Protein O-mannose kinase
UniProt Gene Name
POMK
UniProt Synonym Gene Names
SGK196; POMK
UniProt Entry Name
SG196_HUMAN

NCBI Description

This gene encodes a protein that may be involved in the presentation of the laminin-binding O-linked carbohydrate chain of alpha-dystroglycan (a-DG), which forms transmembrane linkages between the extracellular matrix and the exoskeleton. Some pathogens use this O-linked carbohydrate unit for host entry. Loss of function compound heterozygous mutations in this gene were found in a human patient affected by the Walker-Warburg syndrome (WWS) phenotype. Mice lacking this gene contain misplaced neurons (heterotopia) in some regions of the brain, possibly from defects in neuronal migration. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013]

Uniprot Description

POMK: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily.

Protein type: EC 2.7.1.183; Protein kinase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; Protein kinase, Other; Membrane protein, integral; Kinase, protein; Other group; Other-Unique family

Chromosomal Location of Human Ortholog: 8p11.21

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: ATP binding; carbohydrate kinase activity; phosphotransferase activity, alcohol group as acceptor; protein kinase activity

Biological Process: brain development; carbohydrate phosphorylation; learning and/or memory; neuromuscular process; neuron migration; protein amino acid O-linked glycosylation; protein amino acid phosphorylation; sensory perception of pain

Disease: Muscular Dystrophy-dystroglycanopathy (congenital With Brain And Eye Anomalies), Type A, 12; Muscular Dystrophy-dystroglycanopathy (limb-girdle), Type C, 12

Research Articles on FLJ23356

Similar Products

Product Notes

The FLJ23356 pomk (Catalog #AAA6232882) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FLJ23356 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FLJ23356 pomk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FLJ23356, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.