Mouse anti-Human FHL2 Monoclonal Antibody | anti-FHL2 antibody

FHL2 (Four and a Half LIM Domains Protein 2, FHL-2 Protein, Aging Associated Gene 11, AAG11, DRAL, LIM Domain Protein DRAL, Skeletal Muscle LIM Protein 3, SLIM3) (PE)

Cat. Num. AAA6157815

• Gene Names: FHL2; DRAL; AAG11; FHL-2; SLIM3; SLIM-3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FHL2; Monoclonal Antibody; FHL2 (Four and a Half LIM Domains Protein 2; FHL-2 Protein; Aging Associated Gene 11; AAG11; DRAL; LIM Domain Protein DRAL; Skeletal Muscle LIM Protein 3; SLIM3) (PE); anti-FHL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G3-1A5
• Specificity: Recognizes human FHL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1892

• Applicable Applications for anti-FHL2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-279 from human FHL2 (AAH14397) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.43kD).)

Western Blot (WB)

(FHL2 monoclonal antibody, Western Blot analysis of FHL2 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FHL2 on HeLa cell. [antibody concentration 10ug/ml.)

Product Categories/Family for anti-FHL2 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 17939426
• NCBI GeneID: 2274
• NCBI Official Full Name: Homo sapiens four and a half LIM domains 2, mRNA
• NCBI Official Synonym Full Names: four and a half LIM domains 2
• NCBI Official Symbol: FHL2
• NCBI Official Synonym Symbols: DRAL; AAG11; FHL-2; SLIM3; SLIM-3
• NCBI Protein Information: four and a half LIM domains protein 2
• Protein Family: Four and a half LIM domains protein

NCBI Description

This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]