Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in HeLa.)

Mouse FGL2 Monoclonal Antibody | anti-FGL2 antibody

FGL2 (Fibrinogen-like 2, T49, pT49) (AP)

Gene Names
FGL2; T49; pT49
Applications
Western Blot
Purity
Purified
Synonyms
FGL2; Monoclonal Antibody; FGL2 (Fibrinogen-like 2; T49; pT49) (AP); Fibrinogen-like 2; pT49; anti-FGL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5A10
Specificity
Recognizes FGL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-FGL2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FGL2 (NP_006673, 24aa-123aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in HeLa.)

Western Blot (WB) (FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in HeLa.)

Western Blot (WB)

(FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in PC-12.)

Western Blot (WB) (FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in PC-12.)

Western Blot (WB)

(FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in Raw 264.7.)

Western Blot (WB) (FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged FGL2 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FGL2 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-FGL2 antibody
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq]
Product Categories/Family for anti-FGL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48
NCBI Official Full Name
fibroleukin
NCBI Official Synonym Full Names
fibrinogen like 2
NCBI Official Symbol
FGL2
NCBI Official Synonym Symbols
T49; pT49
NCBI Protein Information
fibroleukin
UniProt Protein Name
Fibroleukin
Protein Family
UniProt Gene Name
FGL2
UniProt Entry Name
FGL2_HUMAN

NCBI Description

The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008]

Uniprot Description

FGL2: May play a role in physiologic lymphocyte functions at mucosal sites.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: fibrinogen complex

Research Articles on FGL2

Similar Products

Product Notes

The FGL2 fgl2 (Catalog #AAA6163854) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FGL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGL2 fgl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.