Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FGFR2 Monoclonal Antibody | anti-FGFR2 antibody

FGFR2 (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (MaxLight 750)

Gene Names
FGFR2; BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGFR2; Monoclonal Antibody; FGFR2 (Fibroblast Growth Factor Receptor 2; FGFR-2; Keratinocyte Growth Factor Receptor; K-sam; CD332; BEK; KGFR; KSAM) (MaxLight 750); anti-FGFR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G3
Specificity
Recognizes human FGFR2. Crossreacts with human FGFR1 and FGFR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-FGFR2 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa621-723 from human FGFR2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-FGFR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
72.0 kDa
NCBI Official Full Name
Homo sapiens fibroblast growth factor receptor 2, mRNA
NCBI Official Synonym Full Names
fibroblast growth factor receptor 2
NCBI Official Symbol
FGFR2
NCBI Official Synonym Symbols
BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM
NCBI Protein Information
fibroblast growth factor receptor 2
UniProt Protein Name
Fibroblast growth factor receptor 2
UniProt Gene Name
FGFR2
UniProt Synonym Gene Names
BEK; KGFR; KSAM; FGFR-2; KGFR
UniProt Entry Name
FGFR2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009]

Uniprot Description

FGFR2: a receptor tyrosine kinase of the highly-conserved FGFR family that binds fibroblast growth factor (FGF). Mutations are associated with many craniosynostotic syndromes and bone malformations. Mutations cause syndromes with defects in facial and limb development, including Crouzon syndrome, Beare-Stevenson cutis gyrata syndrome, Pfeiffer syndrome, Apert syndrome, and Jackson-Weiss syndrome. Somatic mutations seen in gastric cancer. Amplified in gastric, breast and some B cell cancers, but deleted in glioblastoma Twenty splice-variant isoforms have been described.

Protein type: Kinase, protein; EC 2.7.10.1; Protein kinase, tyrosine (receptor); Oncoprotein; Membrane protein, integral; Protein kinase, TK; TK group; FGFR family

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: Golgi apparatus; cell surface; intracellular membrane-bound organelle; integral to plasma membrane; cytoplasmic membrane-bound vesicle; integral to membrane; extracellular region; excitatory synapse; cell cortex; nucleoplasm; extracellular matrix; membrane; cytoplasm; plasma membrane; nucleus

Molecular Function: heparin binding; protein binding; protein homodimerization activity; fibroblast growth factor binding; fibroblast growth factor receptor activity; protein-tyrosine kinase activity; ATP binding

Biological Process: nerve growth factor receptor signaling pathway; mesodermal cell differentiation; embryonic pattern specification; post-embryonic development; embryonic organ morphogenesis; morphogenesis of embryonic epithelium; cell-cell signaling; embryonic digestive tract morphogenesis; positive regulation of mesenchymal cell proliferation; midbrain development; ventricular cardiac muscle morphogenesis; neuromuscular junction development; positive regulation of cardiac muscle cell proliferation; inner ear morphogenesis; cell fate commitment; fibroblast growth factor receptor signaling pathway; regulation of osteoblast differentiation; regulation of fibroblast growth factor receptor signaling pathway; positive regulation of cell cycle; embryonic cranial skeleton morphogenesis; neuroblast division in the ventricular zone; organ growth; organ morphogenesis; mesenchymal cell differentiation; positive regulation of cell division; negative regulation of mitosis; embryonic organ development; positive regulation of transcription from RNA polymerase II promoter; gland morphogenesis; alveolus development; positive regulation of epithelial cell proliferation; peptidyl-tyrosine phosphorylation; branching morphogenesis of a nerve; apoptosis; positive regulation of smooth muscle cell proliferation; protein amino acid autophosphorylation; pyramidal neuron development; negative regulation of transcription from RNA polymerase II promoter; orbitofrontal cortex development; bone mineralization; odontogenesis; regulation of osteoblast proliferation; epithelial cell differentiation; positive regulation of MAPKKK cascade; ureteric bud development; epidermis morphogenesis; regulation of smooth muscle cell differentiation; positive regulation of cell proliferation; lacrimal gland development; angiogenesis; otic vesicle formation; positive regulation of Wnt receptor signaling pathway; negative regulation of epithelial cell proliferation; epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; hair follicle morphogenesis; in utero embryonic development; multicellular organism growth; synaptic vesicle transport; regulation of multicellular organism growth; limb bud formation; gut development; axonogenesis; skeletal morphogenesis; regulation of cell fate commitment; insulin receptor signaling pathway; epithelial to mesenchymal transition; innate immune response; reproductive structure development; lung development; regulation of smoothened signaling pathway

Disease: Pfeiffer Syndrome; Lacrimoauriculodentodigital Syndrome; Scaphocephaly, Maxillary Retrusion, And Mental Retardation; Apert Syndrome; Gastric Cancer; Jackson-weiss Syndrome; Beare-stevenson Cutis Gyrata Syndrome; Crouzon Syndrome; Antley-bixler Syndrome Without Genital Anomalies Or Disordered Steroidogenesis; Bent Bone Dysplasia Syndrome; Saethre-chotzen Syndrome

Research Articles on FGFR2

Similar Products

Product Notes

The FGFR2 fgfr2 (Catalog #AAA6232854) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGFR2 (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGFR2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGFR2 fgfr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGFR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.