Mouse anti-Human FGF21 Monoclonal Antibody | anti-FGF21 antibody

FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (HRP)

Cat. Num. AAA6152499

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FGF21; Monoclonal Antibody; FGF21 (Fibroblast Growth Factor 21; FGF-21; UNQ3115/PRO10196) (HRP); anti-FGF21 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F11
• Specificity: Recognizes human FGF21.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-FGF21 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa30-210 from human FGF21 (AAH18404) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.91kD).)

Western Blot (WB)

(Western Blot analysis of FGF21 expression in transfected 293T cell line by FGF21 monoclonal antibody. Lane 1: FGF21 transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FGF21 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of FGF21 transfected lysate using FGF21 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF21 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged FGF21 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-FGF21 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 22450793
• NCBI GeneID: 26291
• UniProt Accession #: Q9NSA1; Q8N683
• Molecular Weight: 22,300 Da
• NCBI Official Full Name: Homo sapiens fibroblast growth factor 21, mRNA
• NCBI Official Synonym Full Names: fibroblast growth factor 21
• NCBI Official Symbol: FGF21
• NCBI Protein Information: fibroblast growth factor 21
• UniProt Protein Name: Fibroblast growth factor 21
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF21
• UniProt Synonym Gene Names: FGF-21
• UniProt Entry Name: FGF21_HUMAN

NCBI Description

Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue. [provided by RefSeq, Mar 2016]

Uniprot Description

FGF21: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. Belongs to the heparin-binding growth factors family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: extracellular region

Molecular Function: protein binding; growth factor activity; fibroblast growth factor receptor binding

Biological Process: positive regulation of glucose import; cell-cell signaling; positive regulation of cell proliferation; positive regulation of low-density lipoprotein receptor biosynthetic process; signal transduction