Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse FDX1 Monoclonal Antibody | anti-FDX1 antibody

FDX1 (Ferredoxin 1, ADX, FDX, LOH11CR1D) (MaxLight 550)

Gene Names
FDX1; ADX; FDX; LOH11CR1D
Applications
Western Blot
Purity
Purified
Synonyms
FDX1; Monoclonal Antibody; FDX1 (Ferredoxin 1; ADX; FDX; LOH11CR1D) (MaxLight 550); Ferredoxin 1; LOH11CR1D; anti-FDX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4G5
Specificity
Recognizes FDX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-FDX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FDX1 (NP_004100.1, 85aa-183aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKT
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FDX1 antibody
The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq]
Product Categories/Family for anti-FDX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,393 Da
NCBI Official Full Name
adrenodoxin, mitochondrial
NCBI Official Synonym Full Names
ferredoxin 1
NCBI Official Symbol
FDX1
NCBI Official Synonym Symbols
ADX; FDX; LOH11CR1D
NCBI Protein Information
adrenodoxin, mitochondrial; adrenal ferredoxin; ferredoxin-1; hepatoredoxin; mitochondrial adrenodoxin
UniProt Protein Name
Adrenodoxin, mitochondrial
Protein Family
UniProt Gene Name
FDX1
UniProt Synonym Gene Names
ADX
UniProt Entry Name
ADX_HUMAN

NCBI Description

This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]

Uniprot Description

adrenodoxin: Participates in the synthesis of thyroid hormones. Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to cytochrome P450 cholesterol side-chain cleavage enzyme. Belongs to the adrenodoxin/putidaredoxin family.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 11q22

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: 2 iron, 2 sulfur cluster binding; electron carrier activity; iron ion binding

Biological Process: steroid metabolic process; cholesterol metabolic process; xenobiotic metabolic process; C21-steroid hormone biosynthetic process; hormone biosynthetic process; sterol metabolic process

Research Articles on FDX1

Similar Products

Product Notes

The FDX1 fdx1 (Catalog #AAA6216829) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FDX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FDX1 fdx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FDX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.