Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FBXW11 on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human FBXW11 Monoclonal Antibody | anti-FBXW11 antibody

FBXW11 (BTRCP2, FBW1B, FBXW1B, KIAA0696, F-box/WD Repeat-containing Protein 11, F-box and WD Repeats Protein beta-TrCP2, F-box/WD Repeat-containing Protein 1B, Homologous to Slimb Protein) (AP)

Gene Names
FBXW11; Hos; BTRC2; FBW1B; Fbw11; BTRCP2; FBXW1B
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXW11; Monoclonal Antibody; FBXW11 (BTRCP2; FBW1B; FBXW1B; KIAA0696; F-box/WD Repeat-containing Protein 11; F-box and WD Repeats Protein beta-TrCP2; F-box/WD Repeat-containing Protein 1B; Homologous to Slimb Protein) (AP); anti-FBXW11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E7
Specificity
Recognizes human FBXW11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-FBXW11 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-530 from FBXW11 (AAH26213) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FBXW11 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FBXW11 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between WEE1 and FBXW11. HeLa cells were stained with WEE1 rabbit purified polyclonal 1:1200 and FBXW11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between WEE1 and FBXW11. HeLa cells were stained with WEE1 rabbit purified polyclonal 1:1200 and FBXW11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-FBXW11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
60,898 Da
NCBI Official Full Name
Homo sapiens F-box and WD repeat domain containing 11, mRNA
NCBI Official Synonym Full Names
F-box and WD repeat domain containing 11
NCBI Official Symbol
FBXW11
NCBI Official Synonym Symbols
Hos; BTRC2; FBW1B; Fbw11; BTRCP2; FBXW1B
NCBI Protein Information
F-box/WD repeat-containing protein 11; F-box and WD repeats protein beta-TrCP2; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box protein Fbw1b; F-box/WD repeat-containing protein 1B; beta-transducin repeat-containing protein 2;

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. [provided by RefSeq, Jul 2008]

Research Articles on FBXW11

Similar Products

Product Notes

The FBXW11 (Catalog #AAA6131270) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXW11 (BTRCP2, FBW1B, FBXW1B, KIAA0696, F-box/WD Repeat-containing Protein 11, F-box and WD Repeats Protein beta-TrCP2, F-box/WD Repeat-containing Protein 1B, Homologous to Slimb Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXW11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXW11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXW11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.