Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.58kD).)

Mouse anti-Human FBXO8 Monoclonal Antibody | anti-FBXO8 antibody

FBXO8 (F-box Only Protein 8, F-box/SEC7 Protein FBS, FBS, FBX8, DC10, UNQ1877/PRO4320) (AP)

Gene Names
FBXO8; FBS; DC10; FBX8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXO8; Monoclonal Antibody; FBXO8 (F-box Only Protein 8; F-box/SEC7 Protein FBS; FBS; FBX8; DC10; UNQ1877/PRO4320) (AP); anti-FBXO8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C11
Specificity
Recognizes human FBXO8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-FBXO8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-78 from human FBXO8 (NP_036312) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPE*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.58kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.58kD).)

Testing Data

(Detection limit for recombinant GST tagged FBXO8 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FBXO8 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-FBXO8 antibody
May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP.
Product Categories/Family for anti-FBXO8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,426 Da
NCBI Official Full Name
F-box only protein 8
NCBI Official Synonym Full Names
F-box protein 8
NCBI Official Symbol
FBXO8
NCBI Official Synonym Symbols
FBS; DC10; FBX8
NCBI Protein Information
F-box only protein 8; F-box protein Fbx8; F-box/SEC7 protein FBS
UniProt Protein Name
F-box only protein 8
Protein Family
UniProt Gene Name
FBXO8
UniProt Synonym Gene Names
FBS; FBX8
UniProt Entry Name
FBX8_HUMAN

Similar Products

Product Notes

The FBXO8 fbxo8 (Catalog #AAA6131268) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXO8 (F-box Only Protein 8, F-box/SEC7 Protein FBS, FBS, FBX8, DC10, UNQ1877/PRO4320) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXO8 fbxo8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.