Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody. Lane 1: FBXO2 transfected lysate (33.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FBXO2 Monoclonal Antibody | anti-FBXO2 antibody

FBXO2 (F-box Only Protein 2, FBX2, Fbg1, FBG1, Nfb42, NFB42, OCP1) (PE)

Gene Names
FBXO2; FBG1; FBX2; Fbs1; OCP1; NFB42
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXO2; Monoclonal Antibody; FBXO2 (F-box Only Protein 2; FBX2; Fbg1; FBG1; Nfb42; NFB42; OCP1) (PE); anti-FBXO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G4
Specificity
Recognizes human FBXO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FBXO2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-297 from human FBXO2 (AAH25233) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody. Lane 1: FBXO2 transfected lysate (33.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody. Lane 1: FBXO2 transfected lysate (33.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-FBXO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
33,328 Da
NCBI Official Full Name
Homo sapiens F-box protein 2, mRNA
NCBI Official Synonym Full Names
F-box protein 2
NCBI Official Symbol
FBXO2
NCBI Official Synonym Symbols
FBG1; FBX2; Fbs1; OCP1; NFB42
NCBI Protein Information
F-box only protein 2
Protein Family

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. [provided by RefSeq, Jul 2008]

Research Articles on FBXO2

Similar Products

Product Notes

The FBXO2 (Catalog #AAA6157770) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXO2 (F-box Only Protein 2, FBX2, Fbg1, FBG1, Nfb42, NFB42, OCP1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXO2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.