Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Mouse anti-Human FARSLA Monoclonal Antibody | anti-FARSA antibody

FARSLA (Phenylalanyl-tRNA Synthetase alpha Chain, Phenylalanine-tRNA Ligase alpha Chain, PheRS, CML33, FARS, FARSL, FARSLA)

Gene Names
FARSA; FRSA; CML33; FARSL; PheHA; FARSLA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FARSLA; Monoclonal Antibody; FARSLA (Phenylalanyl-tRNA Synthetase alpha Chain; Phenylalanine-tRNA Ligase alpha Chain; PheRS; CML33; FARS; FARSL; FARSLA); Anti -FARSLA (Phenylalanyl-tRNA Synthetase alpha Chain; anti-FARSA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D8
Specificity
Recognizes human FARSLA.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS
Applicable Applications for anti-FARSA antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa101-201 from human FARSLA (NP_004452) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB)

(FARSLA monoclonal antibody, Western Blot analysis of FARSLA expression in MCF-7.)

Western Blot (WB) (FARSLA monoclonal antibody, Western Blot analysis of FARSLA expression in MCF-7.)
Related Product Information for anti-FARSA antibody
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARSA is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This protein has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression.
Product Categories/Family for anti-FARSA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
57,564 Da
NCBI Official Full Name
FARSLA
NCBI Official Synonym Full Names
phenylalanyl-tRNA synthetase, alpha subunit
NCBI Official Symbol
FARSA
NCBI Official Synonym Symbols
FRSA; CML33; FARSL; PheHA; FARSLA
NCBI Protein Information
phenylalanine--tRNA ligase alpha subunit; pheRS; phenylalanine--tRNA ligase alpha chain; phenylalanyl-tRNA synthetase alpha chain; phenylalanine-tRNA synthetase alpha-subunit; phenylalanine tRNA ligase 1, alpha, cytoplasmic; phenylalanyl-tRNA synthetase-like, alpha subunit; phenylalanine-tRNA synthetase-like, alpha subunit
UniProt Protein Name
FARSLA protein
UniProt Gene Name
FARSLA
UniProt Entry Name
Q6IBR2_HUMAN

NCBI Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq, Jul 2008]

Uniprot Description

FARSLA: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq, Jul 2008]

Protein type: RNA-binding; EC 6.1.1.20; Ligase; Translation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: protein binding; phenylalanine-tRNA ligase activity; ATP binding; tRNA binding

Biological Process: tRNA aminoacylation for protein translation; phenylalanyl-tRNA aminoacylation; gene expression

Research Articles on FARSA

Similar Products

Product Notes

The FARSA farsla (Catalog #AAA6000381) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FARSLA (Phenylalanyl-tRNA Synthetase alpha Chain, Phenylalanine-tRNA Ligase alpha Chain, PheRS, CML33, FARS, FARSL, FARSLA) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FARSLA can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the FARSA farsla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KVGFSKAMSN KWIRVDKSAA DGPRVFRVVD SMEDEVQRRL QLVRGGQAEK LGEKERSELR KRKLLAEVTL KTYWVSKGSA FSTSISKQET ELSPEMISSG S. It is sometimes possible for the material contained within the vial of "FARSLA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.