Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Mouse anti-Human FARS2 Monoclonal Antibody | anti-FARS2 antibody

FARS2 (FARS1, Phenylalanine-tRNA Ligase, Mitochondrial, Phenylalanyl-tRNA Synthetase) (FITC)

Gene Names
FARS2; FARS1; PheRS; SPG77; COXPD14; HSPC320
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FARS2; Monoclonal Antibody; FARS2 (FARS1; Phenylalanine-tRNA Ligase; Mitochondrial; Phenylalanyl-tRNA Synthetase) (FITC); anti-FARS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F1
Specificity
Recognizes human FARS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FARS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa351-451 from FARS2 (NP_006558) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Testing Data

(Detection limit for recombinant GST tagged FARS2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FARS2 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-FARS2 antibody
FARS2 encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of individual chromosome ends. The protein structure contains a C-terminal Myb motif, a dimerization domain near its N-terminus and an acidic N-terminus.
Product Categories/Family for anti-FARS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.6kDa (436aa), confirmed by MALDI-TOF
NCBI Official Full Name
phenylalanine--tRNA ligase, mitochondrial
NCBI Official Synonym Full Names
phenylalanyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
FARS2
NCBI Official Synonym Symbols
FARS1; PheRS; SPG77; COXPD14; HSPC320
NCBI Protein Information
phenylalanine--tRNA ligase, mitochondrial
UniProt Protein Name
Phenylalanine--tRNA ligase, mitochondrial
UniProt Gene Name
FARS2
UniProt Synonym Gene Names
FARS1; PheRS
UniProt Entry Name
SYFM_HUMAN

NCBI Description

This gene encodes a protein that transfers phenylalanine to its cognate tRNA. This protein localizes to the mitochondrion and plays a role in mitochondrial protein translation. Mutations in this gene can cause combined oxidative phosphorylation deficiency 14 (Alpers encephalopathy). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

FARS2: Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins. Belongs to the class-II aminoacyl-tRNA synthetase family.

Protein type: EC 6.1.1.20; RNA-binding; Translation; Mitochondrial; Ligase

Chromosomal Location of Human Ortholog: 6p25.1

Cellular Component: mitochondrial matrix

Molecular Function: phenylalanine-tRNA ligase activity; magnesium ion binding; ATP binding; tRNA binding

Biological Process: tRNA aminoacylation for protein translation; tRNA processing; phenylalanyl-tRNA aminoacylation; gene expression

Disease: Combined Oxidative Phosphorylation Deficiency 14

Research Articles on FARS2

Similar Products

Product Notes

The FARS2 fars2 (Catalog #AAA6147145) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FARS2 (FARS1, Phenylalanine-tRNA Ligase, Mitochondrial, Phenylalanyl-tRNA Synthetase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FARS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FARS2 fars2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FARS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.