<
Western Blot (WB)
(Western Blot detection against Immunogen (58.23kD).)
Mouse anti-Human FAM84A Monoclonal Antibody
FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517)
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
FAM84A; Monoclonal Antibody; FAM84A (Protein FAM84A; Neurologic Sensory Protein 1; NSE1; FLJ35392; PP11517); Anti -FAM84A (Protein FAM84A; anti-FAM84A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C2
Specificity
Recognizes human NSE1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Applicable Applications for anti-FAM84A antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml
Immunogen
Full length recombinant protein corresponding to aa1-293 from human NSE1 (AAH26346) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (58.23kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (58.23kD).)
Western Blot (WB)
(Western Blot analysis of NSE1 expression in HL-60 using MBS642935.)
Western Blot (WB)
(Western Blot analysis of NSE1 expression in HL-60 using MBS642935.)
Immunohistochemistry (IHC)
(Immunoperoxidase on formalin-fixed paraffin-embedded human prostate cancer using MBS642935 (5ug/ml).)
Immunohistochemistry (IHC)
(Immunoperoxidase on formalin-fixed paraffin-embedded human prostate cancer using MBS642935 (5ug/ml).)
Testing Data
(Detection limit for MBS642935 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for MBS642935 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-FAM84A antibody
FAM84A (Family with sequence similarity 84 member A) was identified in a screen for genes up-regulated in colon cancer. It may play a role in cell migration and has a critical role in the progression of colon cancer.
Product Categories/Family for anti-FAM84A antibody
Similar Products
Product Notes
The FAM84A (Catalog #AAA642935) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM84A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml. Researchers should empirically determine the suitability of the FAM84A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGNQLDRITH LNYSELPTGD PSGIEKDELR VGVAYFFSDD EEDLDERGQP DKFGVKAPPG CTPCPESPSR HHHHLLHQLV LNETQFSAFR GQECIFSKVS GGPQGADLSV YAVTALPALC EPGDLLELLW LQHAPEPPAP APHWAVYVGG GQIIHLHQGE IRQDSLYEAG AANVGRVVNS WYRYRPLVAE LVVQNACGHL GLKSEEICWT NSESFAAWCR FGKREFKAGG EVPAGTQPPQ QQYYLKVHLG ENKVHTARFH SLEDLIREKR RIDASGRLRV LQELADLVDD KE. It is sometimes possible for the material contained within the vial of "FAM84A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
