Mouse anti-Human EXOC7 Monoclonal Antibody | anti-EXOC7 antibody

EXOC7 (Exocyst Complex Component 7, Exocyst Complex Component Exo70, EXO70, KIAA1067) (FITC)

Cat. Num. AAA6147102

• Gene Names: EXOC7; EX070; EXO70; EXOC1; 2-5-3p; Exo70p; YJL085W
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EXOC7; Monoclonal Antibody; EXOC7 (Exocyst Complex Component 7; Exocyst Complex Component Exo70; EXO70; KIAA1067) (FITC); anti-EXOC7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D4
• Specificity: Recognizes human EXOC7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-EXOC7 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa586-685 from XOC7 (NP_001013861) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(EXOC7 monoclonal antibody Western Blot analysis of EXOC7 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EXOC7 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged EXOC7 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-EXOC7 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 62241046
• NCBI GeneID: 23265
• NCBI Accession #: NP_001013861
• NCBI GenBank Nucleotide #: NM_001013839
• UniProt Accession #: Q9UPT5; Q8ND93; Q8WV91; Q96FF0; Q9H8C3; Q9H9X3; Q9HA32; B5MC69; B8XXP2
• Molecular Weight: 80,650 Da
• NCBI Official Full Name: exocyst complex component 7 isoform 1
• NCBI Official Synonym Full Names: exocyst complex component 7
• NCBI Official Symbol: EXOC7
• NCBI Official Synonym Symbols: EX070; EXO70; EXOC1; 2-5-3p; Exo70p; YJL085W
• NCBI Protein Information: exocyst complex component 7; exocyst complex component Exo70
• UniProt Protein Name: Exocyst complex component 7
• Protein Family: Exocyst complex component
• UniProt Gene Name: EXOC7
• UniProt Synonym Gene Names: EXO70; KIAA1067
• UniProt Entry Name: EXOC7_HUMAN

Uniprot Description

EXOC7: Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. In adipocytes, plays a crucial role in targeting SLC2A4 vesicle to the plasma membrane in response to insulin, perhaps directing the vesicle to the precise site of fusion. Belongs to the EXO70 family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: membrane; exocyst; plasma membrane; microtubule organizing center; cytosol

Molecular Function: protein binding

Biological Process: protein transport; cellular protein metabolic process; exocytosis; organelle organization and biogenesis