Western Blot (WB)
(Western Blot detection against Immunogen (37.99kD).)
Mouse anti-Human EVX1 Monoclonal Antibody | anti-EVX1 antibody
EVX1 (Homeobox Even-skipped Homolog Protein 1, EVX-1)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
EVX1; Monoclonal Antibody; EVX1 (Homeobox Even-skipped Homolog Protein 1; EVX-1); Anti -EVX1 (Homeobox Even-skipped Homolog Protein 1; anti-EVX1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F4
Specificity
Recognizes human EVX1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQP
Applicable Applications for anti-EVX1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa2-110 from human EVX1 (NP_001980) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.99kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.99kD).)
Western Blot (WB)
(EVX1 monoclonal antibody, Western Blot analysis of EVX1 expression in HeLa.)
Western Blot (WB)
(EVX1 monoclonal antibody, Western Blot analysis of EVX1 expression in HeLa.)
Related Product Information for anti-EVX1 antibody
EVX1 is a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. This protein may play an important role as a transcriptional repressor during embryogenesis.
Product Categories/Family for anti-EVX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
42,440 Da
NCBI Official Full Name
EVX1
UniProt Protein Name
Homeobox even-skipped homolog protein 1
Protein Family
UniProt Gene Name
EVX1
UniProt Entry Name
EVX1_HUMAN
Uniprot Description
EVX1: May play a role in the specification of neuronal cell types. Belongs to the even-skipped homeobox family.
Protein type: Transcription factor; DNA-binding
Chromosomal Location of Human Ortholog: 7p15.2
Cellular Component: nucleus
Molecular Function: sequence-specific DNA binding; transcription factor activity
Biological Process: embryonic development ending in birth or egg hatching; regulation of transcription from RNA polymerase II promoter involved in ventral spinal cord interneuron specification; positive regulation of transcription from RNA polymerase II promoter
Similar Products
Product Notes
The EVX1 evx1 (Catalog #AAA642487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EVX1 (Homeobox Even-skipped Homolog Protein 1, EVX-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EVX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the EVX1 evx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ESRKDMVVFL DGGQLGTLVG KRVSNLSEAV GSPLPEPPEK MVPRGCLSPR AVPPATRERG GGGPEEEPVD GLAGSAAGPG AEPQVAGAAM LGPGPPAPSV DSLSGQGQP. It is sometimes possible for the material contained within the vial of "EVX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
