Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human ESR1 Monoclonal Antibody | anti-ESR1 antibody

ESR1 (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (PE)

Gene Names
ESR1; ER; ESR; Era; ESRA; NR3A1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ESR1; Monoclonal Antibody; ESR1 (ESR1; ESR; NR3A1; Estrogen receptor; ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1) (PE); anti-ESR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Specificity
Recognizes human ESR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ESR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa41-140 from human ESR1 (NP_000116.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged ESR1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ESR1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-ESR1 antibody
This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.
Product Categories/Family for anti-ESR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,216 Da
NCBI Official Full Name
estrogen receptor
NCBI Official Synonym Full Names
estrogen receptor 1
NCBI Official Symbol
ESR1
NCBI Official Synonym Symbols
ER; ESR; Era; ESRA; NR3A1
NCBI Protein Information
estrogen receptor; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha E1-E2-1-2; estrogen receptor alpha E1-N2-E2-1-2; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen
UniProt Protein Name
Estrogen receptor
Protein Family
UniProt Gene Name
ESR1
UniProt Synonym Gene Names
ESR; NR3A1; ER
UniProt Entry Name
ESR1_HUMAN

NCBI Description

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters. [provided by RefSeq, Jul 2008]

Uniprot Description

ER-alpha: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: nucleoplasm; Golgi apparatus; membrane; cytoplasm; plasma membrane; integral to membrane; nucleus

Molecular Function: identical protein binding; estrogen receptor activity; zinc ion binding; nitric-oxide synthase regulator activity; beta-catenin binding; estrogen response element binding; transcription factor binding; steroid binding; protein binding; enzyme binding; steroid hormone receptor activity; chromatin binding; transcription factor activity

Biological Process: estrogen receptor signaling pathway; positive regulation of nitric oxide biosynthetic process; uterus development; signal transduction; response to estradiol stimulus; regulation of apoptosis; positive regulation of fibroblast proliferation; elevation of cytosolic calcium ion concentration; regulation of transcription, DNA-dependent; epithelial cell development; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; antral ovarian follicle growth; positive regulation of nitric-oxide synthase activity; negative regulation of transcription factor activity; male gonad development; androgen metabolic process; vagina development; positive regulation of retinoic acid receptor signaling pathway; negative regulation of I-kappaB kinase/NF-kappaB cascade; chromatin remodeling; response to estrogen stimulus; gene expression; positive regulation of transcription factor activity; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling

Disease: Breast Cancer; Migraine With Or Without Aura, Susceptibility To, 1; Myocardial Infarction, Susceptibility To; Estrogen Resistance

Research Articles on ESR1

Similar Products

Product Notes

The ESR1 esr1 (Catalog #AAA6157690) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ESR1 (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ESR1 esr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ESR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.