Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human ESM1 Monoclonal Antibody | anti-ESM1 antibody

ESM1 (Endothelial Cell-specific Molecule 1, ESM-1) (PE)

Gene Names
ESM1; endocan
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ESM1; Monoclonal Antibody; ESM1 (Endothelial Cell-specific Molecule 1; ESM-1) (PE); anti-ESM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6D4
Specificity
Recognizes human ESM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ESM1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa85-185 from human ESM1 (NP_008967) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 monoclonal antibody. Lane 1: ESM1 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 monoclonal antibody. Lane 1: ESM1 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ESM1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ESM1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ESM1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ESM1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ESM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.5 kDa (188aa)
NCBI Official Full Name
endothelial cell-specific molecule 1 isoform a
NCBI Official Synonym Full Names
endothelial cell specific molecule 1
NCBI Official Symbol
ESM1
NCBI Official Synonym Symbols
endocan
NCBI Protein Information
endothelial cell-specific molecule 1
UniProt Protein Name
Endothelial cell-specific molecule 1
UniProt Gene Name
ESM1
UniProt Synonym Gene Names
ESM-1
UniProt Entry Name
ESM1_HUMAN

NCBI Description

This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

ESM1: May have potent implications in lung endothelial cell- leukocyte interactions. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: extracellular region

Molecular Function: integrin binding; insulin-like growth factor binding; hepatocyte growth factor receptor binding

Biological Process: positive regulation of cell proliferation; regulation of cell growth; angiogenesis; sprouting angiogenesis

Research Articles on ESM1

Similar Products

Product Notes

The ESM1 esm1 (Catalog #AAA6157688) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ESM1 (Endothelial Cell-specific Molecule 1, ESM-1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ESM1 esm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ESM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.