Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human EREG Monoclonal Antibody | anti-EREG antibody

EREG (Proepiregulin, Epiregulin, EPR) (MaxLight 550)

Gene Names
EREG; ER; Ep; EPR
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EREG; Monoclonal Antibody; EREG (Proepiregulin; Epiregulin; EPR) (MaxLight 550); anti-EREG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E6
Specificity
Recognizes human EREG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-EREG antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa32-117 from human EREG (NP_001423) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EREG antibody
Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.
Product Categories/Family for anti-EREG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7.7 kDa (69aa)
NCBI Official Full Name
proepiregulin preproprotein
NCBI Official Synonym Full Names
epiregulin
NCBI Official Symbol
EREG
NCBI Official Synonym Symbols
ER; Ep; EPR
NCBI Protein Information
proepiregulin
UniProt Protein Name
Proepiregulin
Protein Family
UniProt Gene Name
EREG
UniProt Synonym Gene Names
EPR
UniProt Entry Name
EREG_HUMAN

NCBI Description

This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4 (ERBB4). The encoded protein may be involved in a wide range of biological processes including inflammation, wound healing, oocyte maturation, and cell proliferation. Additionally, the encoded protein may promote the progression of cancers of various human tissues. [provided by RefSeq, Jul 2015]

Uniprot Description

Epiregulin: Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular region; extracellular space; integral to plasma membrane

Molecular Function: epidermal growth factor receptor binding; growth factor activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity

Biological Process: anatomical structure morphogenesis; cell-cell signaling; cytokine and chemokine mediated signaling pathway; epidermal growth factor receptor signaling pathway; female meiosis; keratinocyte differentiation; keratinocyte proliferation; luteinizing hormone signaling pathway; MAPKKK cascade; mRNA transcription; negative regulation of cell proliferation; negative regulation of epithelial cell proliferation; negative regulation of smooth muscle cell differentiation; negative regulation of transcription, DNA-dependent; oocyte maturation; organ morphogenesis; ovarian cumulus expansion; ovulation; phosphoinositide-mediated signaling; positive regulation of cell proliferation; positive regulation of cytokine biosynthetic process; positive regulation of cytokine production; positive regulation of DNA replication; positive regulation of epidermal growth factor receptor activity; positive regulation of fibroblast proliferation; positive regulation of innate immune response; positive regulation of interleukin-6 biosynthetic process; positive regulation of mitosis; positive regulation of phosphorylation; positive regulation of protein kinase activity; positive regulation of smooth muscle cell proliferation; primary follicle stage, oogenesis; regulation of phosphoinositide 3-kinase cascade; wound healing

Research Articles on EREG

Similar Products

Product Notes

The EREG ereg (Catalog #AAA6211377) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EREG (Proepiregulin, Epiregulin, EPR) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EREG can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EREG ereg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EREG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.