Mouse ERBB3 Monoclonal Antibody | anti-ERBB3 antibody

ERBB3 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian), ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3) (APC)

Cat. Num. AAA6166516

• Gene Names: ERBB3; HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
• Applications: Immunohistochemistry
• Purity: Purified
• Synonyms: ERBB3; Monoclonal Antibody; ERBB3 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian); ErbB-3; HER3; LCCS2; MDA-BF-1; MGC88033; c-erbB-3; c-erbB3; erbB3-S; p180-ErbB3; p45-sErbB3; p85-sErbB3) (APC); v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian); p85-sErbB3; anti-ERBB3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F12
• Specificity: Recognizes ERBB3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 331

• Applicable Applications for anti-ERBB3 antibody: Immunohistochemistry (IHC)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ERBB3 (AAH02706, 21aa-331aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ERBB3 is approximately 3ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 1.2 ug/ml])

Related Product Information for anti-ERBB3 antibody

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq]

Product Categories/Family for anti-ERBB3 antibody

Antibodies; Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 12803739
• NCBI GeneID: 2065
• NCBI Official Full Name: ERBB3 protein
• NCBI Official Synonym Full Names: erb-b2 receptor tyrosine kinase 3
• NCBI Official Symbol: ERBB3
• NCBI Official Synonym Symbols: HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
• NCBI Protein Information: receptor tyrosine-protein kinase erbB-3
• Protein Family: Receptor tyrosine-protein kinase

NCBI Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]