Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ERAF Monoclonal Antibody | anti-ERAF antibody

ERAF (Erythroid Associated Factor, AHSP, EDRF) (MaxLight 405)

Gene Names
AHSP; EDRF; ERAF
Applications
Western Blot
Purity
Purified
Synonyms
ERAF; Monoclonal Antibody; ERAF (Erythroid Associated Factor; AHSP; EDRF) (MaxLight 405); Erythroid Associated Factor; EDRF; anti-ERAF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C9
Specificity
Recognizes ERAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-ERAF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ERAF (NP_057717, 1aa-102aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ERAF antibody
Mouse monoclonal antibody raised against a partial recombinant ERAF.
Product Categories/Family for anti-ERAF antibody
References
1. Transgenic human alpha-hemoglobin stabilizing protein could partially relieve betaIVS-2-654-thalassemia syndrome in model mice. Wang B, Fang Y, Guo X, Ren Z, Zhang J.Hum Gene Ther. 2010 Feb; 21(2):149-56.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.8 kDa (102aa), confirmed by MALDI-TOF.
NCBI Official Full Name
alpha-hemoglobin-stabilizing protein
NCBI Official Synonym Full Names
alpha hemoglobin stabilizing protein
NCBI Official Symbol
AHSP
NCBI Official Synonym Symbols
EDRF; ERAF
NCBI Protein Information
alpha-hemoglobin-stabilizing protein
UniProt Protein Name
Alpha-hemoglobin-stabilizing protein
UniProt Gene Name
AHSP
UniProt Synonym Gene Names
EDRF; ERAF
UniProt Entry Name
AHSP_HUMAN

NCBI Description

This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

AHSP: Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. Belongs to the AHSP family.

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: hemoglobin complex

Molecular Function: hemoglobin binding; unfolded protein binding

Biological Process: protein folding; protein stabilization; hemoglobin metabolic process; hemopoiesis

Research Articles on ERAF

Similar Products

Product Notes

The ERAF ahsp (Catalog #AAA6195384) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ERAF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERAF ahsp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.