Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EPM2AIP1 monoclonal antibody (M02), clone 5G7. Western Blot analysis of EPM2AIP1 expression in HeLa (Cat # L013V1).)

Mouse EPM2AIP1 Monoclonal Antibody | anti-EPM2AIP1 antibody

EPM2AIP1 (EPM2A (laforin) Interacting Protein 1, FLJ11207, KIAA0766) (FITC)

Applications
Western Blot
Purity
Purified
Synonyms
EPM2AIP1; Monoclonal Antibody; EPM2AIP1 (EPM2A (laforin) Interacting Protein 1; FLJ11207; KIAA0766) (FITC); EPM2A (laforin) Interacting Protein 1; KIAA0766; anti-EPM2AIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5G7
Specificity
Recognizes EPM2AIP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-EPM2AIP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EPM2AIP1 (NP_055620, 508aa-606aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(EPM2AIP1 monoclonal antibody (M02), clone 5G7. Western Blot analysis of EPM2AIP1 expression in HeLa (Cat # L013V1).)

Western Blot (WB) (EPM2AIP1 monoclonal antibody (M02), clone 5G7. Western Blot analysis of EPM2AIP1 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged EPM2AIP1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPM2AIP1 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-EPM2AIP1 antibody
The EPM2A gene, which encodes laforin, is mutated in an autosomal recessive form of adolescent progressive myoclonus epilepsy. The protein encoded by this gene binds to laforin, but its function is not known. This gene is intronless. [provided by RefSeq]
Product Categories/Family for anti-EPM2AIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,370 Da
NCBI Official Full Name
EPM2A-interacting protein 1
NCBI Official Synonym Full Names
EPM2A (laforin) interacting protein 1
NCBI Official Symbol
EPM2AIP1
NCBI Protein Information
EPM2A-interacting protein 1; EPM2A interacting protein 1; laforin-interacting protein
UniProt Protein Name
EPM2A-interacting protein 1
Protein Family
UniProt Gene Name
EPM2AIP1
UniProt Synonym Gene Names
KIAA0766
UniProt Entry Name
EPMIP_HUMAN

Uniprot Description

EPM2AIP1: Interacts with EPM2A.

Protein type: Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: endoplasmic reticulum; nucleus

Biological Process: positive regulation of glycogen biosynthetic process; response to insulin stimulus

Similar Products

Product Notes

The EPM2AIP1 epm2aip1 (Catalog #AAA6177007) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EPM2AIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPM2AIP1 epm2aip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPM2AIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.