Mouse EPHA5 Monoclonal Antibody | anti-EPHA5 antibody

EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4) (AP)

Cat. Num. AAA6165379

• Gene Names: EPHA5; EK7; CEK7; EHK1; HEK7; EHK-1; TYRO4
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: EPHA5; Monoclonal Antibody; EPHA5 (EPH Receptor A5; CEK7; EHK1; HEK7; TYRO4) (AP); EPH Receptor A5; TYRO4; anti-EPHA5 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: X1
• Specificity: Recognizes EPHA5.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-EPHA5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: EPHA5 (NP_004430, 234aa-333aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-EPHA5 antibody

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-EPHA5 antibody

Antibodies; Receptors; Tyrosine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 221625401
• NCBI GeneID: 2044
• NCBI Accession #: NP_004430
• NCBI GenBank Nucleotide #: NM_004439.7
• UniProt Accession #: P54756; Q7Z3F2
• Molecular Weight: 107,699 Da
• NCBI Official Full Name: ephrin type-A receptor 5 isoform a
• NCBI Official Synonym Full Names: EPH receptor A5
• NCBI Official Symbol: EPHA5
• NCBI Official Synonym Symbols: EK7; CEK7; EHK1; HEK7; EHK-1; TYRO4
• NCBI Protein Information: ephrin type-A receptor 5
• UniProt Protein Name: Ephrin type-A receptor 5
• Protein Family: Ephrin type-A receptor
• UniProt Gene Name: EPHA5
• UniProt Synonym Gene Names: BSK; EHK1; HEK7; TYRO4; EHK-1; EK7; hEK7
• UniProt Entry Name: EPHA5_HUMAN

NCBI Description

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

Uniprot Description

EphA5: Receptor tyrosine kinase which binds promiscuously GPI- anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino- hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. Beside its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; EC 2.7.10.1; TK group; Eph family

Chromosomal Location of Human Ortholog: 4q13.1

Cellular Component: rough endoplasmic reticulum; cell soma; axon; perinuclear region of cytoplasm; integral to plasma membrane; dendrite; plasma membrane; external side of plasma membrane

Molecular Function: transmembrane-ephrin receptor activity; GPI-linked ephrin receptor activity; ephrin receptor activity; ATP binding

Biological Process: axon guidance; cAMP-mediated signaling; peptidyl-tyrosine phosphorylation; regulation of actin cytoskeleton organization and biogenesis; hippocampus development; activation of CREB transcription factor; ephrin receptor signaling pathway; neuron development