Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ENTH monoclonal antibody Western Blot analysis of ENTH expression in Raw 264.7)

Mouse ENTH Monoclonal Antibody | anti-ENTH antibody

ENTH (Clathrin Interactor 1, Epsin-4, Epsin-related Protein, EpsinR, Enthoprotin, Clathrin-interacting Protein Localized in the Trans-Golgi region, Clint, KIAA0171, EPNR, EPN4, CLINT1) (AP)

Gene Names
CLINT1; ENTH; EPN4; EPNR; CLINT
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENTH; Monoclonal Antibody; ENTH (Clathrin Interactor 1; Epsin-4; Epsin-related Protein; EpsinR; Enthoprotin; Clathrin-interacting Protein Localized in the Trans-Golgi region; Clint; KIAA0171; EPNR; EPN4; CLINT1) (AP); anti-ENTH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E6
Specificity
Recognizes human ENTH. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3952
Applicable Applications for anti-ENTH antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa161-261 from ENTH (NP_055481) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ENTH monoclonal antibody Western Blot analysis of ENTH expression in Raw 264.7)

Western Blot (WB) (ENTH monoclonal antibody Western Blot analysis of ENTH expression in Raw 264.7)

Western Blot (WB)

(ENTH monoclonal antibody Western Blot analysis of ENTH expression in Jurkat)

Western Blot (WB) (ENTH monoclonal antibody Western Blot analysis of ENTH expression in Jurkat)

Western Blot (WB)

(ENTH monoclonal antibody Western Blot analysis of ENTH expression in NIH/3T3)

Western Blot (WB) (ENTH monoclonal antibody Western Blot analysis of ENTH expression in NIH/3T3)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CLINT1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CLINT1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CLINT1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CLINT1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ENTH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens clathrin interactor 1 (CLINT1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
clathrin interactor 1
NCBI Official Symbol
CLINT1
NCBI Official Synonym Symbols
ENTH; EPN4; EPNR; CLINT
NCBI Protein Information
clathrin interactor 1
UniProt Protein Name
Clathrin interactor 1
Protein Family
UniProt Gene Name
CLINT1
UniProt Synonym Gene Names
ENTH; EPN4; EPNR; KIAA0171; Clint; EpsinR
UniProt Entry Name
EPN4_HUMAN

NCBI Description

This gene encodes a protein with similarity to the epsin family of endocytic adapter proteins. The encoded protein interacts with clathrin, the adapter protein AP-1 and phosphoinositides. This protein may be involved in the formation of clathrin coated vesicles and trafficking between the trans-Golgi network and endosomes. Mutations in this gene are associated with a susceptibility to schizophrenia and psychotic disorders. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]

Uniprot Description

ENTH: Binds to membranes enriched in phosphatidylinositol 4,5- bisphosphate (PtdIns(4,5)P2). May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes. Stimulates clathrin assembly. Belongs to the epsin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5q33.3

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; membrane; clathrin-coated vesicle; perinuclear region of cytoplasm; cytosol

Molecular Function: protein binding; clathrin binding; lipid binding

Biological Process: clathrin cage assembly; endocytosis; post-Golgi vesicle-mediated transport

Disease: Schizophrenia 1

Research Articles on ENTH

Similar Products

Product Notes

The ENTH clint1 (Catalog #AAA6131132) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENTH (Clathrin Interactor 1, Epsin-4, Epsin-related Protein, EpsinR, Enthoprotin, Clathrin-interacting Protein Localized in the Trans-Golgi region, Clint, KIAA0171, EPNR, EPN4, CLINT1) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENTH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENTH clint1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENTH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.