Mouse anti-Human ENO3 Monoclonal Antibody | anti-ENO3 antibody

ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (PE)

Cat. Num. AAA6157644

• Gene Names: ENO3; MSE; GSD13
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ENO3; Monoclonal Antibody; ENO3 (Enolase 3; 2-phospho-D-glycerate Hydro-lyase; beta-Enolase; Muscle-specific Enolase; MSE; Skeletal Muscle Enolase) (PE); anti-ENO3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5D1
• Specificity: Recognizes human ENO3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ENO3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.24kD).)

Western Blot (WB)

(Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody. Lane 1: ENO3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-ENO3 antibody

Antibodies; Enzymes

References

1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.

NCBI and Uniprot Product Information

• NCBI GI #: 301897469
• NCBI GeneID: 2027
• NCBI Accession #: NP_001967
• NCBI GenBank Nucleotide #: NM_001976
• UniProt Accession #: P13929
• Molecular Weight: 47kDa
• NCBI Official Full Name: beta-enolase isoform 1
• NCBI Official Synonym Full Names: enolase 3
• NCBI Official Symbol: ENO3
• NCBI Official Synonym Symbols: MSE; GSD13
• NCBI Protein Information: beta-enolase
• UniProt Protein Name: Beta-enolase
• Protein Family: Enolase
• UniProt Gene Name: ENO3
• UniProt Synonym Gene Names: MSE
• UniProt Entry Name: ENOB_HUMAN

NCBI Description

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jul 2010]

Uniprot Description

ENO3: Appears to have a function in striated muscle development and regeneration. Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13). A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen- beta particles are detected on ultrastructural analysis. Belongs to the enolase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lyase; Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 4.2.1.11

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: extracellular space; phosphopyruvate hydratase complex; cytoplasm; plasma membrane; cytosol

Molecular Function: protein homodimerization activity; protein heterodimerization activity; magnesium ion binding; phosphopyruvate hydratase activity

Biological Process: response to drug; glycolysis; carbohydrate metabolic process; skeletal muscle regeneration; glucose metabolic process; pathogenesis; gluconeogenesis; aging

Disease: Glycogen Storage Disease Xiii