Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ENC1 Monoclonal Antibody | anti-ENC1 antibody

ENC1 (Ectoderm-neural Cortex Protein 1, ENC-1, Kelch-like Protein 37, Nuclear Matrix Protein NRP/B, p53-induced Gene 10 Protein, KLHL37, NRPB, PIG10, FLJ39259) (MaxLight 490)

Gene Names
ENC1; NRPB; CCL28; ENC-1; PIG10; KLHL35; KLHL37; TP53I10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENC1; Monoclonal Antibody; ENC1 (Ectoderm-neural Cortex Protein 1; ENC-1; Kelch-like Protein 37; Nuclear Matrix Protein NRP/B; p53-induced Gene 10 Protein; KLHL37; NRPB; PIG10; FLJ39259) (MaxLight 490); anti-ENC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B1
Specificity
Recognizes human ENC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ENC1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa17-99 from ENC1 (NP_003624) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ENC1 antibody
Actin-binding protein involved in the regulation of neuronal process formation and in differentiation of neural crest cells. Down-regulates transcription factor NF2L2/NRF2 by decreasing the rate of protein synthesis and not via a ubiquitin-mediated proteasomal degradation mechanism.
Product Categories/Family for anti-ENC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
ectoderm-neural cortex protein 1 isoform 1
NCBI Official Synonym Full Names
ectodermal-neural cortex 1
NCBI Official Symbol
ENC1
NCBI Official Synonym Symbols
NRPB; CCL28; ENC-1; PIG10; KLHL35; KLHL37; TP53I10
NCBI Protein Information
ectoderm-neural cortex protein 1
UniProt Protein Name
Ectoderm-neural cortex protein 1
UniProt Gene Name
ENC1
UniProt Synonym Gene Names
KLHL37; NRPB; PIG10; ENC-1
UniProt Entry Name
ENC1_HUMAN

NCBI Description

This gene encodes a member of the kelch-related family of actin-binding proteins. The encoded protein plays a role in the oxidative stress response as a regulator of the transcription factor Nrf2, and expression of this gene may play a role in malignant transformation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

ENC1: Actin-binding protein involved in the regulation of neuronal process formation and in differentiation of neural crest cells. May be down-regulated in neuroblastoma tumors. Substrate- specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Protein type: Actin-binding

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: nucleoplasm; cytoskeleton; nuclear matrix; cell soma; nuclear chromatin; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; actin binding

Biological Process: nervous system development; negative regulation of translation; multicellular organismal development; proteasomal ubiquitin-independent protein catabolic process; protein ubiquitination

Research Articles on ENC1

Similar Products

Product Notes

The ENC1 enc1 (Catalog #AAA6200660) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENC1 (Ectoderm-neural Cortex Protein 1, ENC-1, Kelch-like Protein 37, Nuclear Matrix Protein NRP/B, p53-induced Gene 10 Protein, KLHL37, NRPB, PIG10, FLJ39259) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENC1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENC1 enc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.