Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to EMX2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml].)

Mouse anti-Human EMX2 Monoclonal Antibody | anti-EMX2 antibody

EMX2 (Homeobox Protein EMX2, Empty Spiracles Homolog 2, Empty Spiracles-like Protein 2) APC

Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EMX2; Monoclonal Antibody; EMX2 (Homeobox Protein EMX2; Empty Spiracles Homolog 2; Empty Spiracles-like Protein 2) APC; anti-EMX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F7
Specificity
Recognizes human EMX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EMX2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa103-200 from human EMX2 (NP_004089) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to EMX2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to EMX2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-EMX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
homeobox protein EMX2 isoform 1
NCBI Official Synonym Full Names
empty spiracles homeobox 2
NCBI Official Symbol
EMX2
NCBI Protein Information
homeobox protein EMX2
UniProt Protein Name
Homeobox protein EMX2
Protein Family
UniProt Gene Name
EMX2
UniProt Entry Name
EMX2_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

EMX2: Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. Defects in EMX2 are the cause of schizencephaly (SCHZC). Schizencephaly is an extremely rare human congenital disorder characterized by a full-thickness cleft within the cerebral hemispheres. These clefts are lined with gray matter and most commonly involve the parasylvian regions. Large portions of the cerebral hemispheres may be absent and replaced by cerebro- spinal fluid. Belongs to the EMX homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 10q26.1

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: response to drug; forebrain cell migration; anterior/posterior pattern formation; neuron differentiation; dentate gyrus development; regulation of transcription, DNA-dependent; cell proliferation in forebrain; cerebral cortex regionalization

Disease: Schizencephaly

Research Articles on EMX2

Similar Products

Product Notes

The EMX2 emx2 (Catalog #AAA6136420) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EMX2 (Homeobox Protein EMX2, Empty Spiracles Homolog 2, Empty Spiracles-like Protein 2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EMX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EMX2 emx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EMX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.