Testing Data
(Detection limit for recombinant GST tagged EML4 is 0.1 ng/ml as a capture antibody.)
Mouse EML4 Monoclonal Antibody | anti-EML4 antibody
EML4 (echinoderm Microtubule Associated Protein like 4, C2orf2, DKFZp686P18118, ELP120, FLJ10942, FLJ32318, ROPP120) (PE)
Gene Names
EML4; C2orf2; ELP120; EMAP-4; EMAPL4; ROPP120
Applications
Western Blot
Purity
Purified
Synonyms
EML4; Monoclonal Antibody; EML4 (echinoderm Microtubule Associated Protein like 4; C2orf2; DKFZp686P18118; ELP120; FLJ10942; FLJ32318; ROPP120) (PE); echinoderm Microtubule Associated Protein like 4; ROPP120; anti-EML4 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F2
Specificity
Recognizes EML4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
62
Applicable Applications for anti-EML4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EML4 (AAH08685, 1aa-62aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged EML4 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged EML4 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-EML4 antibody
Mouse monoclonal antibody raised against a full-length recombinant EML4.
Product Categories/Family for anti-EML4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
EML4 protein
NCBI Official Synonym Full Names
EMAP like 4
NCBI Official Symbol
EML4
NCBI Official Synonym Symbols
C2orf2; ELP120; EMAP-4; EMAPL4; ROPP120
NCBI Protein Information
echinoderm microtubule-associated protein-like 4
Protein Family
NCBI Description
This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq, Jan 2015]
Research Articles on EML4
Similar Products
Product Notes
The EML4 (Catalog #AAA6187004) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EML4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EML4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EML4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
