Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EMID2 is 0.1 ng/ml as a capture antibody.)

Mouse EMID2 Monoclonal Antibody | anti-EMID2 antibody

EMID2 (EMI Domain Containing 2, COL26A1, EMI6, EMU2, MGC129848, hEmu2) (PE)

Gene Names
COL26A1; EMI6; EMU2; SH2B; EMID2
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
EMID2; Monoclonal Antibody; EMID2 (EMI Domain Containing 2; COL26A1; EMI6; EMU2; MGC129848; hEmu2) (PE); EMI Domain Containing 2; hEmu2; anti-EMID2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D10
Specificity
Recognizes EMID2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-EMID2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EMID2 (NP_597714, 380aa-440aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASSR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EMID2 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EMID2 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-EMID2 antibody
Mouse monoclonal antibody raised against a partial recombinant EMID2.
Product Categories/Family for anti-EMID2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
collagen alpha-1(XXVI) chain isoform 2
NCBI Official Synonym Full Names
collagen type XXVI alpha 1 chain
NCBI Official Symbol
COL26A1
NCBI Official Synonym Symbols
EMI6; EMU2; SH2B; EMID2
NCBI Protein Information
collagen alpha-1(XXVI) chain
UniProt Protein Name
Collagen alpha-1(XXVI) chain
UniProt Gene Name
COL26A1
UniProt Synonym Gene Names
EMID2; EMU2; Emu2
UniProt Entry Name
COQA1_HUMAN

NCBI Description

This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

EMID2: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: extracellular matrix; Golgi apparatus; proteinaceous extracellular matrix; collagen; endoplasmic reticulum lumen; plasma membrane; extracellular region

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis

Research Articles on EMID2

Similar Products

Product Notes

The EMID2 col26a1 (Catalog #AAA6187938) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EMID2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EMID2 col26a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EMID2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.