Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ELOF1 expression in transfected 293T cell line by ELOF1 monoclonal antibody (M06), clone 4F6.Lane 1: ELOF1 transfected lysate (Predicted MW: 9.5 KDa).Lane 2: Non-transfected lysate.)

Mouse ELOF1 Monoclonal Antibody | anti-ELOF1 antibody

ELOF1 (Elongation Factor 1 Homolog (S. cerevisiae), ELF1) (APC)

Gene Names
ELOF1; ELF1
Applications
Western Blot
Purity
Purified
Synonyms
ELOF1; Monoclonal Antibody; ELOF1 (Elongation Factor 1 Homolog (S. cerevisiae); ELF1) (APC); Elongation Factor 1 Homolog (S. cerevisiae); ELF1; anti-ELOF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F6
Specificity
Recognizes ELOF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ELOF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ELOF1 (NP_115753.1, 1aa-83aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ELOF1 expression in transfected 293T cell line by ELOF1 monoclonal antibody (M06), clone 4F6.Lane 1: ELOF1 transfected lysate (Predicted MW: 9.5 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ELOF1 expression in transfected 293T cell line by ELOF1 monoclonal antibody (M06), clone 4F6.Lane 1: ELOF1 transfected lysate (Predicted MW: 9.5 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ELOF1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELOF1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-ELOF1 antibody
Mouse monoclonal antibody raised against a full-length recombinant ELOF1.
Product Categories/Family for anti-ELOF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,462 Da
NCBI Official Full Name
transcription elongation factor 1 homolog
NCBI Official Synonym Full Names
elongation factor 1 homolog (S. cerevisiae)
NCBI Official Symbol
ELOF1
NCBI Official Synonym Symbols
ELF1
NCBI Protein Information
transcription elongation factor 1 homolog; elongation factor 1 homolog (ELF1, S. cerevisiae)
UniProt Protein Name
Transcription elongation factor 1 homolog
UniProt Gene Name
ELOF1
UniProt Entry Name
ELOF1_HUMAN

Uniprot Description

ELOF1: Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions. Belongs to the ELOF1 family.

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleus

Molecular Function: metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The ELOF1 elof1 (Catalog #AAA6169872) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ELOF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELOF1 elof1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELOF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.