Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Mouse anti-Human ELK3 Monoclonal Antibody | anti-ELK3 antibody
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC
Gene Names
ELK3; ERP; NET; SAP2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELK3; Monoclonal Antibody; ELK3 (ETS Domain-containing Protein Elk-3; ETS-related Protein ERP; ETS-related Protein NET; Serum Response Factor Accessory Protein 2; SAP-2; SRF Accessory Protein 2; NET; SAP2) APC; anti-ELK3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A12
Specificity
Recognizes human ELK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ELK3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-200 from human ELK3 (NP_005221.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody. Lane 1: ELK3 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody. Lane 1: ELK3 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged ELK3 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ELK3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ELK3 antibody
May be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element.
Product Categories/Family for anti-ELK3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,240 Da
NCBI Official Full Name
ETS domain-containing protein Elk-3
NCBI Official Synonym Full Names
ELK3, ETS-domain protein (SRF accessory protein 2)
NCBI Official Symbol
ELK3
NCBI Official Synonym Symbols
ERP; NET; SAP2
NCBI Protein Information
ETS domain-containing protein Elk-3; SAP-2; ETS-domain protein; ETS-related protein ERP; ETS-related protein NET; SRF accessory protein 2; serum response factor accessory protein 2
UniProt Protein Name
ETS domain-containing protein Elk-3
Protein Family
UniProt Gene Name
ELK3
UniProt Synonym Gene Names
NET; SAP2; SAP-2
UniProt Entry Name
ELK3_HUMAN
Similar Products
Product Notes
The ELK3 elk3 (Catalog #AAA6136412) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELK3 elk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
