Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ELF3 Monoclonal Antibody | anti-ELF3 antibody

ELF3 (E74-like Factor 3 (ets Domain Transcription Factor, Epithelial-specific), EPR-1, ERT, Epithelium-specific Ets Transcription Factor 1, ESE-1, Epithelial-restricted with Serine Box, ESX) (Biotin)

Gene Names
ELF3; ERT; ESX; EPR-1; ESE-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELF3; Monoclonal Antibody; ELF3 (E74-like Factor 3 (ets Domain Transcription Factor; Epithelial-specific); EPR-1; ERT; Epithelium-specific Ets Transcription Factor 1; ESE-1; Epithelial-restricted with Serine Box; ESX) (Biotin); anti-ELF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D8
Specificity
Recognizes human ELF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ELF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa262-371 from human ELF3 (AAH03569) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ELF3 monoclonal antibody, Western Blot analysis of ELF3 expression in A-431.)

Western Blot (WB) (ELF3 monoclonal antibody, Western Blot analysis of ELF3 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged ELF3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELF3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ELF3 antibody
ELF3 is a 41-43kD member of the ETS family of proteins. During uncomplicated (non-inflammatory) periods of cell differentiation, ELF3 is expressed exclusively by epithelial cells, repressing genes needed during early differentiation, and promoting genes needed for full differentiation. Under conditions of inflammation, cells such as monocytes, endothelial cells and chrondrocytes express ELF3 and produce molecules such as Ang1 and COX2. Human ELF3 is 371aa in length. It contains one PNT/pointed dimerization domain aa46-132, a protein stabilizing PEST sequence aa210-225, an A/T Hook region that binds to AT-rich DNA sequences aa236-252, and an ETS DNA binding domain aa273-355. ELF3 interacts with CREBBP, EP300, KU70 and KU86. There is one splice variant that shows a deletion of aa174-200. Over aa1-173, human ELF3 shares 87aa identity with mouse ELF3.
Product Categories/Family for anti-ELF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39,357 Da
NCBI Official Full Name
Homo sapiens E74-like factor 3 (ets domain transcription factor, epithelial-specific), mRNA
NCBI Official Synonym Full Names
E74 like ETS transcription factor 3
NCBI Official Symbol
ELF3
NCBI Official Synonym Symbols
ERT; ESX; EPR-1; ESE-1
NCBI Protein Information
ETS-related transcription factor Elf-3
Protein Family

Research Articles on ELF3

Similar Products

Product Notes

The ELF3 (Catalog #AAA6141711) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELF3 (E74-like Factor 3 (ets Domain Transcription Factor, Epithelial-specific), EPR-1, ERT, Epithelium-specific Ets Transcription Factor 1, ESE-1, Epithelial-restricted with Serine Box, ESX) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELF3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.