Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human ELF1 Monoclonal Antibody | anti-ELF1 antibody

ELF1 (ETS-related Transcription Factor Elf-1, E74-like Factor 1) (Biotin)

Gene Names
ELF1; RIA1; EFTUD1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELF1; Monoclonal Antibody; ELF1 (ETS-related Transcription Factor Elf-1; E74-like Factor 1) (Biotin); anti-ELF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B7
Specificity
Recognizes human ELF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ELF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa421-520 from human ELF1 (NP_758961) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNGTV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(ELF1 monoclonal antibody, Western Blot analysis of ELF1 expression in 293.)

Western Blot (WB) (ELF1 monoclonal antibody, Western Blot analysis of ELF1 expression in 293.)

Testing Data

(Detection limit for recombinant GST tagged ELF1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELF1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-ELF1 antibody
ELF1 is an E26 transformation-specific related transcription factor. The protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes.
Product Categories/Family for anti-ELF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
ETS-related transcription factor Elf-1 isoform a
NCBI Official Synonym Full Names
E74 like ETS transcription factor 1
NCBI Official Symbol
ELF1
NCBI Official Synonym Symbols
RIA1; EFTUD1
NCBI Protein Information
ETS-related transcription factor Elf-1
UniProt Protein Name
ETS-related transcription factor Elf-1
UniProt Gene Name
ELF1
UniProt Entry Name
ELF1_HUMAN

NCBI Description

This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009]

Uniprot Description

Elf-1: Transcription factor that activates the LYN and BLK promoters. Appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. Binds specifically to two purine-rich motifs in the HIV-2 enhancer. Belongs to the ETS family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 13q13

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; negative regulation of T cell receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; cell differentiation; regulation of cytokine production

Research Articles on ELF1

Similar Products

Product Notes

The ELF1 elf1 (Catalog #AAA6141710) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELF1 (ETS-related Transcription Factor Elf-1, E74-like Factor 1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELF1 elf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.