Mouse ELA3B Monoclonal Antibody | anti-ELA3B antibody

ELA3B (Elastase 3B, Pancreatic) (APC)

Cat. Num. AAA6169826

• Gene Names: CELA3B; CBPP; ELA3B
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: ELA3B; Monoclonal Antibody; ELA3B (Elastase 3B; Pancreatic) (APC); Elastase 3B; Pancreatic; anti-ELA3B antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H3
• Specificity: Recognizes ELA3B.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 270

• Applicable Applications for anti-ELA3B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ELA3B (AAH05216, 19aa-270aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ELA3B expression in transfected 293T cell line by ELA3B monoclonal antibody (M06), clone 3H3.Lane 1: ELA3B transfected lysate (Predicted MW: 29.3 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-ELA3B antibody

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3B has little elastolytic activity. Like most of the human elastases, elastase 3B is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3B preferentially cleaves proteins after alanine residues. Elastase 3B may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1, and excretion of this protein in fecal material is frequently used as a measure of pancreatic function in clinical assays. [provided by RefSeq]

Product Categories/Family for anti-ELA3B antibody

Antibodies; Elastase

NCBI and Uniprot Product Information

• NCBI GI #: 13528831
• NCBI GeneID: 23436
• NCBI Official Full Name: ELA3B protein
• NCBI Official Synonym Full Names: chymotrypsin like elastase 3B
• NCBI Official Symbol: CELA3B
• NCBI Official Synonym Symbols: CBPP; ELA3B
• NCBI Protein Information: chymotrypsin-like elastase family member 3B

NCBI Description

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3B has little elastolytic activity. Like most of the human elastases, elastase 3B is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3B preferentially cleaves proteins after alanine residues. Elastase 3B may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1, and excretion of this protein in fecal material is frequently used as a measure of pancreatic function in clinical assays. [provided by RefSeq, May 2009]